![Western Blot: CaMKIV Antibody (1G4P4) [NBP3-16802] - Western blot analysis of extracts of various cell lines, using CaMKIV antibody (NBP3-16802) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.](http://images.novusbio.com/fullsize/CaMKIV-Antibody-1G4P4-Western-Blot-NBP3-16802-img0006.jpg "Western Blot: CaMKIV Antibody (1G4P4) [NBP3-16802] - Western blot analysis of extracts of various cell lines, using CaMKIV antibody (NBP3-16802) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clone | 1G4P4 |
| Clonality | Monoclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Additional Information | Recombinant Monoclonal Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 374-473 of human CAMKIV (Q16566). EGEKIQGDGAQAAVKGAQAELMKVQALEKVKGADINAEEAPKMVPKAVEDGIKVADLELEEGLAEEKLKTVEEAAAPREGQGSSAVGFEVPQQDVILPEY |
| Isotype | IgG |
| Clonality | Monoclonal |
| Host | Rabbit |
| Gene | CAMK4 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for CaMKIV Antibody (NBP3-16802)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | CAMK4 |
![Immunocytochemistry/Immunofluorescence: CaMKIV Antibody (1G4P4) [NBP3-16802] - Immunofluorescence analysis of U-2 OS cells using CaMKIV Rabbit mAb (NBP3-16802) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/CaMKIV-Antibody-1G4P4-Immunocytochemistry-Immunofluorescence-NBP3-16802-img0005.jpg "Immunocytochemistry/Immunofluorescence: CaMKIV Antibody (1G4P4) [NBP3-16802] - Immunofluorescence analysis of U-2 OS cells using CaMKIV Rabbit mAb (NBP3-16802) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.")
![Immunocytochemistry/Immunofluorescence: CaMKIV Antibody (1G4P4) [NBP3-16802] - Immunofluorescence analysis of NIH-3T3 cells using CaMKIV Rabbit mAb (NBP3-16802) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/CaMKIV-Antibody-1G4P4-Immunocytochemistry-Immunofluorescence-NBP3-16802-img0004.jpg "Immunocytochemistry/Immunofluorescence: CaMKIV Antibody (1G4P4) [NBP3-16802] - Immunofluorescence analysis of NIH-3T3 cells using CaMKIV Rabbit mAb (NBP3-16802) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.")
![Immunohistochemistry: CaMKIV Antibody (1G4P4) [NBP3-16802] - Immunohistochemistry analysis of CaMKIV in paraffin-embedded rat testis tissue using CaMKIV Rabbit mAb at a dilution of 1:800 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-16802_rabbit-camkiv-mab-1g4p4-822025208415.jpg "Immunohistochemistry: CaMKIV Antibody (1G4P4) [NBP3-16802] - Immunohistochemistry analysis of CaMKIV in paraffin-embedded rat testis tissue using CaMKIV Rabbit mAb at a dilution of 1:800 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.")
![Immunohistochemistry: CaMKIV Antibody (1G4P4) [NBP3-16802] - Immunohistochemistry analysis of CaMKIV in paraffin-embedded rat brain tissue using CaMKIV Rabbit mAb at a dilution of 1:800 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-16802_rabbit-camkiv-mab-1g4p4-822025208448.jpg "Immunohistochemistry: CaMKIV Antibody (1G4P4) [NBP3-16802] - Immunohistochemistry analysis of CaMKIV in paraffin-embedded rat brain tissue using CaMKIV Rabbit mAb at a dilution of 1:800 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.")
![Immunohistochemistry: CaMKIV Antibody (1G4P4) [NBP3-16802] - Immunohistochemistry analysis of CaMKIV in paraffin-embedded rat kidney tissue using CaMKIV Rabbit mAb at a dilution of 1:800 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-16802_rabbit-camkiv-mab-1g4p4-8220252010484.jpg "Immunohistochemistry: CaMKIV Antibody (1G4P4) [NBP3-16802] - Immunohistochemistry analysis of CaMKIV in paraffin-embedded rat kidney tissue using CaMKIV Rabbit mAb at a dilution of 1:800 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.")
![Immunohistochemistry: CaMKIV Antibody (1G4P4) [NBP3-16802] - Immunohistochemistry analysis of CaMKIV in paraffin-embedded mouse colon tissue using CaMKIV Rabbit mAb at a dilution of 1:800 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-16802_rabbit-camkiv-mab-1g4p4-822025208485.jpg "Immunohistochemistry: CaMKIV Antibody (1G4P4) [NBP3-16802] - Immunohistochemistry analysis of CaMKIV in paraffin-embedded mouse colon tissue using CaMKIV Rabbit mAb at a dilution of 1:800 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.")
![Immunohistochemistry: CaMKIV Antibody (1G4P4) [NBP3-16802] - Immunohistochemistry analysis of CaMKIV in paraffin-embedded mouse brain tissue using CaMKIV Rabbit mAb at a dilution of 1:800 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-16802_rabbit-camkiv-mab-1g4p4-8220252010477.jpg "Immunohistochemistry: CaMKIV Antibody (1G4P4) [NBP3-16802] - Immunohistochemistry analysis of CaMKIV in paraffin-embedded mouse brain tissue using CaMKIV Rabbit mAb at a dilution of 1:800 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.")
![Immunohistochemistry: CaMKIV Antibody (1G4P4) [NBP3-16802] - Immunohistochemistry analysis of CaMKIV in paraffin-embedded rat colon tissue using CaMKIV Rabbit mAb at a dilution of 1:800 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-16802_rabbit-camkiv-mab-1g4p4-822025208456.jpg "Immunohistochemistry: CaMKIV Antibody (1G4P4) [NBP3-16802] - Immunohistochemistry analysis of CaMKIV in paraffin-embedded rat colon tissue using CaMKIV Rabbit mAb at a dilution of 1:800 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.")
![Immunohistochemistry: CaMKIV Antibody (1G4P4) [NBP3-16802] - Immunohistochemistry analysis of CaMKIV in paraffin-embedded human breast cancer tissue using CaMKIV Rabbit mAb at a dilution of 1:800 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-16802_rabbit-camkiv-mab-1g4p4-8220252010475.jpg "Immunohistochemistry: CaMKIV Antibody (1G4P4) [NBP3-16802] - Immunohistochemistry analysis of CaMKIV in paraffin-embedded human breast cancer tissue using CaMKIV Rabbit mAb at a dilution of 1:800 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.")
![N/A CREB [p Ser133] [Biotin]](https://images.novusbio.com/images2/dyc2510-2_human-mouse-rat-phospho-creb-s133-duoset-ic-elisa-2-plate-712021221341.png)
![N/A CREB [p Ser133] [Biotin]](https://images.novusbio.com/images2/dyc2510-2_human-mouse-rat-phospho-creb-s133-duoset-ic-elisa-2-plate-712021221447.png)
![N/A CREB [p Ser133] [Biotin]](https://images.novusbio.com/images2/dyc2510-2_human-mouse-rat-phospho-creb-s133-duoset-ic-elisa-2-plate-712021221551.png)
![N/A BDNF [HRP]](https://images.novusbio.com/images2/DATA_BDNF_DBD00_ELISA_587.jpg)
![N/A BDNF [HRP]](https://images.novusbio.com/images2/DATA_BDNF_DBD00_ELISA_588.jpg)
![N/A BDNF [HRP]](https://images.novusbio.com/images2/BDNF_DBD00_ELISA_36.jpg)
![Western Blot ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Western_Blot_5097.jpg)
![Immunohistochemistry ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Immunohistochemistry_20696.jpg)
![Knockout Validated ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Knockout_Validated_22864.jpg)
![Bioactivity IL-2 [Unconjugated]](https://images.novusbio.com/images/202-il_recombinant-human-il-2-protein-bioactivity-174202314946.jpg)
![Western Blot CBP/KAT3A Antibody (257003) [Unconjugated]](https://images.novusbio.com/images2/CBP_MAB2676_Western_Blot_6043.jpg)
![Immunocytochemistry CBP/KAT3A Antibody (257003) [Unconjugated]](https://images.novusbio.com/images2/mab2676_human-mouse-rat-cbp-mab-clone-257003-immunocytochemistry-101220208237.jpg)
![Western Blot c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Western_Blot_18923.jpg)
![Immunocytochemistry c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Immunocytochemistry__Immunofluorescence_18945.jpg)
![Simple Western c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Simple_Western_19175.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")