![Immunohistochemistry-Paraffin: Calretinin Antibody [NBP1-88221] - Staining in human testis and skeletal muscle tissues using NBP1-88221 antibody. Corresponding CALB2 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/Calretinin-Antibody-Immunohistochemistry-Paraffin-NBP1-88221-img0038.jpg "Immunohistochemistry-Paraffin: Calretinin Antibody [NBP1-88221] - Staining in human testis and skeletal muscle tissues using NBP1-88221 antibody. Corresponding CALB2 RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC, IHC, KD |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LKGFLSDLLKKANRPYDEPKLQEYTQTILRMFDLNGDGKLGLSEMSRLLPVQENFLLKFQGMKLTSEEFNAIFTFYDKDRSGYIDEHELDALLKDLYEKNKKEMNIQQLTNYRKSVMSLAEAGKLYRKDLEIV |
| Marker | Mesothelial Cell Marker |
| Predicted Species | Rat (98%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CALB2 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. Use in IHC-Free Floating reported in scientific literature (PMID: 31481399). |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Simple Western Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Simple_Western_21888.jpg)
![Immunocytochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunocytochemistry__Immunofluorescence_17777.jpg)
![Immunohistochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunohistochemistry_23317.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for Calretinin Antibody (NBP1-88221)Find related products by research area.
|
|
Using RPE65 as a tool to investigate ocular gene therapies While not life threatening, blindness and retinal disease are profoundly debilitating and greatly affect quality of life. Understandably, gene therapy has been subject to controversy given it’s potential effects on the rest of our cellular ... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | CALB2 |
![Immunohistochemistry-Paraffin: Calretinin Antibody [NBP1-88221] - Staining of human cerebellum, skeletal muscle, stomach and testis using Anti-CALB2 antibody NBP1-88221 (A) shows similar protein distribution across tissues to independent antibody NBP1-88220 (B).](http://images.novusbio.com/fullsize/Calretinin-Antibody-Immunohistochemistry-Paraffin-NBP1-88221-img0034.jpg "Immunohistochemistry-Paraffin: Calretinin Antibody [NBP1-88221] - Staining of human cerebellum, skeletal muscle, stomach and testis using Anti-CALB2 antibody NBP1-88221 (A) shows similar protein distribution across tissues to independent antibody NBP1-88220 (B).")
![Western Blot: Calretinin Antibody [NBP1-88221] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2,. Remaining relative intensity is presented. Loading control: Anti-PPIB.](http://images.novusbio.com/fullsize/Calretinin-Antibody-Western-Blot-NBP1-88221-img0032.jpg "Western Blot: Calretinin Antibody [NBP1-88221] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2,. Remaining relative intensity is presented. Loading control: Anti-PPIB.")
![Immunocytochemistry/Immunofluorescence: Calretinin Antibody [NBP1-88221] - Staining of human cell line U-2 OS shows localization to cytosol. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/Calretinin-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-88221-img0017.jpg "Immunocytochemistry/Immunofluorescence: Calretinin Antibody [NBP1-88221] - Staining of human cell line U-2 OS shows localization to cytosol. Antibody staining is shown in green.")
![Western Blot: Calretinin Antibody [NBP1-88221] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.](http://images.novusbio.com/fullsize/Calretinin-Antibody-Western-Blot-NBP1-88221-img0031.jpg "Western Blot: Calretinin Antibody [NBP1-88221] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.")
![Immunohistochemistry: Calretinin Antibody [NBP1-88221] - Staining of mouse hippocampus shows selective immunoreactivity in the dentate gyrus neurons.](http://images.novusbio.com/fullsize/Calretinin-Antibody-Immunohistochemistry-NBP1-88221-img0018.jpg "Immunohistochemistry: Calretinin Antibody [NBP1-88221] - Staining of mouse hippocampus shows selective immunoreactivity in the dentate gyrus neurons.")
![Immunohistochemistry: Calretinin Antibody [NBP1-88221] - Staining of mouse hypothalamus shows immunoreactivity in neurons of the paraventricular nucleus.](http://images.novusbio.com/fullsize/Calretinin-Antibody-Immunohistochemistry-NBP1-88221-img0019.jpg "Immunohistochemistry: Calretinin Antibody [NBP1-88221] - Staining of mouse hypothalamus shows immunoreactivity in neurons of the paraventricular nucleus.")
![Immunohistochemistry: Calretinin Antibody [NBP1-88221] - Staining of mouse substantia nigra shows neuronal cell bodies and processes in pars compacta.](http://images.novusbio.com/fullsize/Calretinin-Antibody-Immunohistochemistry-NBP1-88221-img0020.jpg "Immunohistochemistry: Calretinin Antibody [NBP1-88221] - Staining of mouse substantia nigra shows neuronal cell bodies and processes in pars compacta.")
![Immunohistochemistry: Calretinin Antibody [NBP1-88221] - Staining of mouse hindbrain shows cytoplasmic immunoreactivity in neurons of the pontine nucleus.](http://images.novusbio.com/fullsize/Calretinin-Antibody-Immunohistochemistry-NBP1-88221-img0021.jpg "Immunohistochemistry: Calretinin Antibody [NBP1-88221] - Staining of mouse hindbrain shows cytoplasmic immunoreactivity in neurons of the pontine nucleus.")
![Immunohistochemistry: Calretinin Antibody [NBP1-88221] - Staining of mouse medulla shows positivity in the gigantocellular reticular nucleus neurons.](http://images.novusbio.com/fullsize/Calretinin-Antibody-Immunohistochemistry-NBP1-88221-img0022.jpg "Immunohistochemistry: Calretinin Antibody [NBP1-88221] - Staining of mouse medulla shows positivity in the gigantocellular reticular nucleus neurons.")
![Immunohistochemistry-Paraffin: Calretinin Antibody [NBP1-88221] - Staining of human cerebellum shows strong cytoplasmic and nuclear positivity in cells in granular layer.](http://images.novusbio.com/fullsize/Calretinin-Antibody-Immunohistochemistry-Paraffin-NBP1-88221-img0033.jpg "Immunohistochemistry-Paraffin: Calretinin Antibody [NBP1-88221] - Staining of human cerebellum shows strong cytoplasmic and nuclear positivity in cells in granular layer.")
![Immunohistochemistry-Paraffin: Calretinin Antibody [NBP1-88221] - Staining of human skeletal muscle shows no positivity in myocytes as expected.](http://images.novusbio.com/fullsize/Calretinin-Antibody-Immunohistochemistry-Paraffin-NBP1-88221-img0035.jpg "Immunohistochemistry-Paraffin: Calretinin Antibody [NBP1-88221] - Staining of human skeletal muscle shows no positivity in myocytes as expected.")
![Immunohistochemistry-Paraffin: Calretinin Antibody [NBP1-88221] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/Calretinin-Antibody-Immunohistochemistry-Paraffin-NBP1-88221-img0036.jpg "Immunohistochemistry-Paraffin: Calretinin Antibody [NBP1-88221] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: Calretinin Antibody [NBP1-88221] - Staining of human testis shows strong cytoplasmic and nuclear positivity in Leydig cells.](http://images.novusbio.com/fullsize/Calretinin-Antibody-Immunohistochemistry-Paraffin-NBP1-88221-img0037.jpg "Immunohistochemistry-Paraffin: Calretinin Antibody [NBP1-88221] - Staining of human testis shows strong cytoplasmic and nuclear positivity in Leydig cells.")
![Bioactivity CTLA-4 [Unconjugated]](https://images.novusbio.com/images2/CTLA4_7268CT_2293.jpg)
![Western Blot GRB2 Antibody [Unconjugated]](https://images.novusbio.com/images2/GRB2_AF3846_Western_Blot_5355.jpg)
![Immunohistochemistry GRB2 Antibody [Unconjugated]](https://images.novusbio.com/images2/GRB2_AF3846_Immunohistochemistry_6809.jpg)
![Western Blot RB1 Antibody (607121) [Unconjugated]](https://images.novusbio.com/images2/RB1_MAB6495_Western_Blot_10216.jpg)
![Immunocytochemistry RB1 Antibody (607121) [Unconjugated]](https://images.novusbio.com/images2/RB1_MAB6495_Immunocytochemistry_10464.jpg)
![Simple Western RB1 Antibody (607121) [Unconjugated]](https://images.novusbio.com/images2/RB1_MAB6495_Simple_Western_16629.jpg)
![Western Blot Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Western_Blot_5287.jpg)
![Simple Western Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Simple_Western_16990.jpg)
![Knockout Validated Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Knockout_Validated_24032.jpg)
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![Immunocytochemistry Integrin alpha 2/CD49b Antibody (HAS3) [Unconjugated]](https://images.novusbio.com/images2/Integrin_alpha_2_MAB1233_Immunocytochemistry__Immunofluorescence_19196.jpg)
![Flow Cytometry Integrin alpha 2/CD49b Antibody (HAS3) [Unconjugated]](https://images.novusbio.com/images2/Integrin_alpha_2_MAB1233_Flow_Cytometry_19476.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")