Novus Biologicals products are now on bio-techne.com

Calpain S1 Recombinant Protein Antigen

Images

 
There are currently no images for Calpain S1 Recombinant Protein Antigen (NBP1-90329PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Calpain S1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to Human Calpain S1.

Source: E. coli

Amino Acid Sequence: THYSNIEANESEEVRQFRRLFAQLAGDDMEVSATELMNILNKVVTRHPDLKTDGFGIDTCRSMVAVMDSDTTGKLGFEEFKYLWNNIKRWQAIYKQFDTDRSGTICSSELPG

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CAPNS1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-90329.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.

Theoretical MW
30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Calpain S1 Recombinant Protein Antigen

  • Calcium-activated neutral proteinase small subunit
  • Calcium-dependent protease small subunit 1
  • calcium-dependent protease, small subunit
  • calpain 4, small subunit (30K)
  • Calpain regulatory subunit
  • calpain small subunit 1
  • calpain, small polypeptide
  • CALPAIN4
  • CANP
  • CANPS
  • CAPN4
  • CDPS
  • CSS1
  • epididymis secretory sperm binding protein

Background

This gene is a member of the calpain small subunit family. Calpains are calcium-dependent cysteine proteinases that are widely distributed in mammalian cells. Calpains operate as heterodimers, comprising a specific large catalytic subunit (calpain 1 subunit in Calpain I, and calpain 2 subunit in Calpain II), and a common small regulatory subunit encoded by this gene. This encoded protein is essential for the stability and function of both calpain heterodimers, whose proteolytic activities influence various cellular functions including apoptosis, proliferation, migration, adhesion, and autophagy. Calpains have been implicated in neurodegenerative processes, such as myotonic dystrophy. A pseudogene of this gene has been defined on chromosome 1. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2014]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88204
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-15671
Species: Hu, Mu, Sq
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP2-01819
Species: Hu
Applications: Flow, IHC, IHC-P, WB
NBP1-89125
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KD, WB
MAB8930
Species: Hu
Applications: ICC, Simple Western, WB
NB600-717
Species: Bv
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RIA, RI, WB
NBP1-32914
Species: Hu, Mu
Applications: ICC/IF, IHC, WB
NBP1-31756
Species: Hu
Applications: ICC/IF, WB
NBP2-62708
Species: Hu
Applications: IHC, IHC-P
NBP1-88087
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-15669
Species: Mu, Rt, Ze
Applications: IHC-WhMt, IHC, WB
AF808
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, IHC, Neut, WB
NBP2-15671
Species: Hu, Mu, Sq
Applications: ICC/IF, IHC, IHC-P, IP, WB
AF1555
Species: Hu
Applications: WB
NB300-223
Species: Bv, Ca, Ch, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP2-50037
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
NBP1-32870
Species: Hu
Applications: IHC, IHC-P, IP, KD, WB
NB110-58748
Species: Hu, Mu
Applications: ICC/IF, KD, Simple Western, WB

Publications for Calpain S1 Recombinant Protein Antigen (NBP1-90329PEP) (0)

There are no publications for Calpain S1 Recombinant Protein Antigen (NBP1-90329PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Calpain S1 Recombinant Protein Antigen (NBP1-90329PEP) (0)

There are no reviews for Calpain S1 Recombinant Protein Antigen (NBP1-90329PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Calpain S1 Recombinant Protein Antigen (NBP1-90329PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Calpain S1 Products

Research Areas for Calpain S1 Recombinant Protein Antigen (NBP1-90329PEP)

Find related products by research area.

Blogs on Calpain S1

There are no specific blogs for Calpain S1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Calpain S1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CAPNS1