![Immunocytochemistry/Immunofluorescence: BRICK1 Antibody [NBP3-03514] - Analysis of U-2 OS cells using BRICK1 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/BRICK1-Antibody-Immunocytochemistry-Immunofluorescence-NBP3-03514-img0001.jpg "Immunocytochemistry/Immunofluorescence: BRICK1 Antibody [NBP3-03514] - Analysis of U-2 OS cells using BRICK1 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.")
| Reactivity | Hu, MuSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-75 of human BRICK1 (NP_060932.2). MAGQEDPVQREIHQDWANREYIEIITSSIKKIADFLNSFDMSCRSRLATLNEKLTALERRIEYIEARVTKGETLT |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | BRK1 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS with 50% glycerol, pH7.3. |
| Preservative | 0.01% Thimerosal |
| Purity | Affinity purified |
![Neutralization CXCL8/IL-8 Antibody (6217) [Unconjugated]](https://images.novusbio.com/images2/CXCL8_MAB208_Block_Neutralize_9064.jpg)
![Immunocytochemistry CXCL8/IL-8 Antibody (6217) [Unconjugated]](https://images.novusbio.com/images2/CXCL8_MAB208_Immunocytochemistry_9339.jpg)
![Western Blot CXCL8/IL-8 Antibody (6217) [Unconjugated]](https://images.novusbio.com/images2/mab208_human-il-8-cxcl8-mab-clone-6217-western-blot-1882021143847.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for BRICK1 Antibody (NBP3-03514)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | BRK1 |
![Immunohistochemistry-Paraffin: BRICK1 Antibody [NBP3-03514] - Paraffin-embedded human breast cancer using BRICK1 antibody at dilution of 1:100 (40x lens).](http://images.novusbio.com/fullsize/BRICK1-Antibody-Immunohistochemistry-Paraffin-NBP3-03514-img0002.jpg "Immunohistochemistry-Paraffin: BRICK1 Antibody [NBP3-03514] - Paraffin-embedded human breast cancer using BRICK1 antibody at dilution of 1:100 (40x lens).")
![Immunohistochemistry-Paraffin: BRICK1 Antibody [NBP3-03514] - Paraffin-embedded human stomach using BRICK1 antibody at dilution of 1:100 (40x lens).](http://images.novusbio.com/fullsize/BRICK1-Antibody-Immunohistochemistry-Paraffin-NBP3-03514-img0003.jpg "Immunohistochemistry-Paraffin: BRICK1 Antibody [NBP3-03514] - Paraffin-embedded human stomach using BRICK1 antibody at dilution of 1:100 (40x lens).")
![Western Blot Angiopoietin-like Protein 2/ANGPTL2 Antibody [Unconjugated]](https://images.novusbio.com/images2/Angiopoietinlike_Protein_2_AF1444_Western_Blot_19840.jpg)
![Immunocytochemistry SOX9 Antibody [Unconjugated]](https://images.novusbio.com/images2/SOX9_AF3075_Immunocytochemistry_15995.jpg)
![Western Blot SOX9 Antibody [Unconjugated]](https://images.novusbio.com/images2/SOX9_AF3075_Western_Blot_21580.jpg)
![Immunocytochemistry SOX9 Antibody [Unconjugated]](https://images.novusbio.com/images2/SOX9_AF3075_Immunocytochemistry_6490.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")