![Western Blot: nef-associated protein 1 Antibody [H00051531-B01P] - Analysis of C9orf156 expression in rat brain.](http://images.novusbio.com/fullsize/nef-associated-protein-1-Antibody-Western-Blot-H00051531-B01P-img0005.jpg "Western Blot: nef-associated protein 1 Antibody [H00051531-B01P] - Analysis of C9orf156 expression in rat brain.")
| Reactivity | Hu, RtSpecies Glossary |
| Applications | WB, ICC/IF |
| Clonality | Polyclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Immunogen | C9orf156 (AAH02863.1, 1 a.a. - 441 a.a.) full-length human protein. MRGLEEPGPRPTATPCGCVKPALETGNLLTEPVGYLESCFSAKNGTPRQPSICSYSRACLRIRKRIFNNPEHSLMGLEQFSHVWILFVFHKNGHLSCKAKVQPPRLNGAKTGVFSTRSPHRPNAIGLTLAKLEKVEGGAIYLSGIDMIHGTPVLDIKPYIAEYDSPQNVMEPLADFNLQNNQHTPNTVSQSDSKTDSCDQRQLSGCDEPQPHHSTKRKPKCPEDRTSEENYLTHSDTARIQQAFPMHREIAVDFGLESRRDQSSSVAEEQIGPYCPEKSFSEKGTDKKLERVEGAAVLQGSRAETQPMAPHCPAGRADGAPRSVVPAWVTEAPVATLEVRFTPHAEMDLGQLSSQDVGQASFKYFQSAEEAKRAIEAVLSADPRSVYRRKLCQDRLFYFTVDIAHVTCWFGDGFAEVLRIKPASEPVHMTGPVGSLVSLGS |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Mouse |
| Gene | C9ORF156 |
| Purity | Protein G purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | This antibody is useful for Western Blot, ELISA, Immunocytochemistry/Immunofluorescence. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.4) |
| Preservative | No Preservative |
| Purity | Protein G purified |
![Neutralization CXCL8/IL-8 Antibody (6217) [Unconjugated]](https://images.novusbio.com/images2/CXCL8_MAB208_Block_Neutralize_9064.jpg)
![Immunocytochemistry CXCL8/IL-8 Antibody (6217) [Unconjugated]](https://images.novusbio.com/images2/CXCL8_MAB208_Immunocytochemistry_9339.jpg)
![Western Blot CXCL8/IL-8 Antibody (6217) [Unconjugated]](https://images.novusbio.com/images2/mab208_human-il-8-cxcl8-mab-clone-6217-western-blot-1882021143847.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | C9ORF156 |
| Uniprot |
|
![Immunocytochemistry/Immunofluorescence: nef-associated protein 1 Antibody [H00051531-B01P] - Analysis of purified antibody to C9orf156 on HeLa cell. (antibody concentration 10 ug/ml)](http://images.novusbio.com/fullsize/nef-associated-protein-1-Antibody-Immunocytochemistry-Immunofluorescence-H00051531-B01P-img0004.jpg "Immunocytochemistry/Immunofluorescence: nef-associated protein 1 Antibody [H00051531-B01P] - Analysis of purified antibody to C9orf156 on HeLa cell. (antibody concentration 10 ug/ml)")
![Western Blot: nef-associated protein 1 Antibody [H00051531-B01P] - Analysis of C9orf156 expression in transfected 293T cell line by C9orf156 polyclonal antibody. Lane 1: C9orf156 transfected lysate(48.51 KDa). Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/nef-associated-protein-1-Antibody-Western-Blot-H00051531-B01P-img0006.jpg "Western Blot: nef-associated protein 1 Antibody [H00051531-B01P] - Analysis of C9orf156 expression in transfected 293T cell line by C9orf156 polyclonal antibody. Lane 1: C9orf156 transfected lysate(48.51 KDa). Lane 2: Non-transfected lysate.")
![Western Blot Angiopoietin-like Protein 2/ANGPTL2 Antibody [Unconjugated]](https://images.novusbio.com/images2/Angiopoietinlike_Protein_2_AF1444_Western_Blot_19840.jpg)
![Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]](https://images.novusbio.com/images/Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP1-97019-img0004.jpg "Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]")