Home » BRCAA1 » BRCAA1 Proteins » BRCAA1 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

BRCAA1 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for BRCAA1 Recombinant Protein Antigen (NBP3-17218PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

BRCAA1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human BRCAA1

Source: E. coli

Amino Acid Sequence: NCKLRRLSKPPFQTNPSPEMVSKLDLTDAKNSDTAHIKSIEITSILNGLQASESSAEDSEQEDERGAQDM

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ARID4B
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-17218.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking tide related information and a protocol, click here.
Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for BRCAA1 Recombinant Protein Antigen

  • 180 kDa Sin3-associated polypeptide
  • ARID domain-containing protein 4B
  • AT rich interactive domain 4B (RBP1- like)
  • AT rich interactive domain 4B (RBP1-like)
  • AT-rich interactive domain-containing protein 4B
  • BRCAA1DKFZp313M2420
  • breast cancer-associated antigen 1
  • Breast cancer-associated antigen BRCAA1
  • breast carcinoma-associated antigen
  • Histone deacetylase complex subunit SAP180
  • Rb-binding protein homolog
  • RBBP1L1RBP1L1BCAA
  • RBP1-like protein
  • retinoblastoma binding protein 1-like 1
  • Retinoblastoma-binding protein 1-like 1
  • SAP180MGC163290
  • SIN3A-associated protein 180
  • Sin3-associated polypeptide p180

Background

ARID4B (AT-rich interactive domain-containing protein 4B) is also known as RbBP1L1 (retinoblastoma binding protein 1-like 1) and is a retinoblastoma binding protein and member of the AT-rich interaction domain (ARID) family of proteins. In addition to the ARID DNA binding domain, ARID4B also contains a chromo domain and a TUDOR domain, indicating a function in chromatin organization and protein-protein interactions with methylated protein substrates. As a subunit of the SIN3A transcriptional co-repressor, ARID4B is implicated to be involved in chromatin remodeling and epigenetic modifications. ARID4B may play a role in the pathogenesis of breast cancer and other malignancies.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Immunocytochemistry Insulin Antibody (182410) [Unconjugated]
Immunohistochemistry Insulin Antibody (182410) [Unconjugated]
(24 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
beta Amyloid
Antibody (MOAB-2) - B ...
NBP2-13075
Immunohistochemistry-Frozen beta Amyloid Antibody (MOAB-2) - BSA Free
Immunohistochemistry beta Amyloid Antibody (MOAB-2) - BSA Free
Immunocytochemistry/ Immunofluorescence beta Amyloid Antibody (MOAB-2) - BSA Free
(2 Reviews)
(69 Publications)
Species: Ba, Hu, Pm, Mu, Rt
Applications: DB, ELISA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, WB
Albumin Antibody
(188835) [Unconjugate ...
MAB1455
Simple Western Albumin Antibody (188835) [Unconjugated] - Serum
Immunocytochemistry Albumin Antibody (188835) [Unconjugated] - Serum
Immunohistochemistry Albumin Antibody (188835) [Unconjugated] - Serum
(3 Reviews)
(54 Publications)
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
AAAS Antibody (5A1)
H00008086-M02
Western Blot AAAS Antibody (5A1)
Immunohistochemistry-Paraffin AAAS Antibody (5A1)
Western Blot AAAS Antibody (5A1)
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
TEAD1 Antibody -
Azide and BSA Free
NBP2-94035
Chromatin Immunoprecipitation TEAD1 Antibody - Azide and BSA Free
Immunocytochemistry/ Immunofluorescence TEAD1 Antibody - Azide and BSA Free
Western Blot TEAD1 Antibody - Azide and BSA Free
Species: Hu, Mu, Rt
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, WB
TOR/mTOR [p
Ser2448] Antibody
NB600-607
Immunohistochemistry-Paraffin TOR/mTOR [p Ser2448] Antibody
Western Blot TOR/mTOR [p Ser2448] Antibody
Data TOR/mTOR [p Ser2448] Antibody
(2 Reviews)
(9 Publications)
Species: Hu, Rt
Applications: ELISA, IHC, IHC-P, WB
Ribosomal Protein
S6/RPS6 [p Ser235, p ...
AF3918
Western Blot Ribosomal Protein S6/RPS6 [p Ser235, p Ser236] Antibody [Unconjugated]
Simple Western Ribosomal Protein S6/RPS6 [p Ser235, p Ser236] Antibody [Unconjugated]
Immunohistochemistry Ribosomal Protein S6/RPS6 [p Ser235, p Ser236] Antibody [Unconjugated]
(6 Publications)
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(807 Publications)
Species: Hu
Applications: BA
Tyrosinase
Antibody (JA52-11)
NBP2-67232
Immunocytochemistry/ Immunofluorescence Tyrosinase Antibody (JA52-11)
Immunocytochemistry/ Immunofluorescence Tyrosinase Antibody (JA52-11)
Immunohistochemistry-Paraffin Tyrosinase Antibody (JA52-11)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
4EBP1 Antibody
NB200-157
Knockout Validated 4EBP1 Antibody
Western Blot 4EBP1 Antibody
Western Blot 4EBP1 Antibody
(45 Publications)
Species: Hu
Applications: IHC, IHC-P, KO, WB
Glucagon Antibody
(181402) [Unconjugate ...
MAB1249
Immunocytochemistry Glucagon Antibody (181402) [Unconjugated]
Intracellular Staining by Flow Cytometry Glucagon Antibody (181402) [Unconjugated]
(1 Review)
(13 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow
Prolactin Antibody
[Unconjugated]
AF1445
Neutralization Prolactin Antibody [Unconjugated]
Western Blot Prolactin Antibody [Unconjugated]
Immunohistochemistry Prolactin Antibody [Unconjugated]
(7 Publications)
Species: Mu, Rt
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, Neut, Simple Western, WB
TYRP1 Antibody
NBP1-88370
Western Blot TYRP1 Antibody
Immunohistochemistry-Paraffin TYRP1 Antibody
Immunohistochemistry-Paraffin TYRP1 Antibody
(4 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
TBP like protein
TLP Antibody
NBP2-49671
Immunohistochemistry-Paraffin TBP like protein TLP Antibody
Immunohistochemistry-Paraffin TBP like protein TLP Antibody
Immunohistochemistry-Paraffin TBP like protein TLP Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P
BCAT2 Antibody
NBP2-33705
Western Blot BCAT2 Antibody
Immunohistochemistry BCAT2 Antibody
Immunohistochemistry-Paraffin BCAT2 Antibody
Species: Hu
Applications: IHC, IHC-P, WB
Holo-Transferrin
[Unconjugated]
2914-HT
Holo-Transferrin [Unconjugated]
(47 Publications)
Species: Hu
Applications: BA
Tbp7 Antibody
NBP1-87799
Immunohistochemistry-Paraffin Tbp7 Antibody
Western Blot Tbp7 Antibody
Western Blot Tbp7 Antibody
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
IGF-I/IGF-1
[Unconjugated]
291-G1
SDS-PAGE IGF-I/IGF-1 [Unconjugated]
Bioactivity IGF-I/IGF-1 [Unconjugated]
Mass Spectrometry IGF-I/IGF-1 [Unconjugated]
(219 Publications)
Species: Hu
Applications: BA
Retinoblastoma
binding protein 1 Ant ...
NBP1-26616
Western Blot Retinoblastoma binding protein 1 Antibody
Immunoprecipitation Retinoblastoma binding protein 1 Antibody
Species: Hu
Applications: IP, WB
BRCAA1 Recombinant
Protein Antigen
NBP3-17218PEP
BRCAA1 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for BRCAA1 Recombinant Protein Antigen (NBP3-17218PEP) (0)

There are no publications for BRCAA1 Recombinant Protein Antigen (NBP3-17218PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BRCAA1 Recombinant Protein Antigen (NBP3-17218PEP) (0)

There are no reviews for BRCAA1 Recombinant Protein Antigen (NBP3-17218PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for BRCAA1 Recombinant Protein Antigen (NBP3-17218PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional BRCAA1 Products

Array NBP3-17218PEP

Research Areas for BRCAA1 Recombinant Protein Antigen (NBP3-17218PEP)

Find related products by research area.

Blogs on BRCAA1

There are no specific blogs for BRCAA1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005
Immunohistochemistry: BRCAA1 Antibody [NBP1-26618] - Sample: FFPE section of human ovarian carcinoma. Antibody: Affinity purified rabbit anti-ARID4B used at a dilution of 1:1,000 ( 1ug/ml). Detection: DAB staining using Immunohistochemistry Accessory Kit .
BRCAA1 Antibody
NBP1-26618

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our BRCAA1 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol ARID4B