I am interesting by anti-BPTF antibody. I would like to know if a large protein like that could be revealed in PVDF membrane?

Name: BPTF/FALZ Recombinant Protein Antigen
Brand: Novus Biologicals
SKU: NBP1-84756PEP
Price: 279 USD

Question

Accepted Answer

Regarding your question, nucleosome-remodeling factor subunit (BPTF) is a very large protein as you have also mentioned (338KD). There are some tips for efficient transfer of these proteins in western blot for instance: 1) Make sure to use a low percentage gel, for BPTF in particular I suggest you use 7% gel or even lower (5%). 2) You can use either Nitrocellulose or PVDF, to my knowledge the binding efficiency is higher for nitrocellulose while PVDF is a better choice of membrane if you are planning to do re-probing and stripping. If you are going to use PVDF, make sure to wet it in 100% methanol before use. Furthermore, PVDF membrane exhibits better binding efficiency of electroblotted material in the presence of SDS in the transfer buffer. However SDS added to facilitate transfer of large proteins should not exceed 0.05% as it will interfere with the binding of the protein to the membrane. 3) For transfer you can either use the semi-dry or wet transfer but you decide doing wet transfer, I strongly recommend you doing the transfer in low voltage (at 50v) for instance in order to obtain an efficient transfer. These are some suggestions I can provide for a better and more efficient transfer for large proteins like BPTF.

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

Reactivity	HuSpecies Glossary
Applications	AC

Description	A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human BPTF. Source: E. coli Amino Acid Sequence: SKLSQLKSQQVAAAAHEANKLFKEGKEVLVVNSQGEISRLSTKKEVIMKGNINNYFKLGQEGKYRVYHNQYSTNSFALNKHQHREDHDKRRHLAHKFCLTPAGEFKWNGSVHGSKVLTISTLRLTITQL Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source	E. coli
Protein/Peptide Type	Recombinant Protein Antigen
Gene	BPTF
Purity	>80% by SDS-PAGE and Coomassie blue staining

Dilutions	Antibody Competition 10 - 100 molar excess
Application Notes	This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84756. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com For further blocking peptide related information and a protocol, click here.
Theoretical MW	32 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Storage	Store at -20C. Avoid freeze-thaw cycles.
Buffer	PBS and 1M Urea, pH 7.4.
Preservative	No Preservative
Purity	>80% by SDS-PAGE and Coomassie blue staining

BPTF/FALZ Recombinant Protein Antigen

Species Glossary

Images

Product Details

Order Details

BPTF/FALZ Recombinant Protein Antigen Summary

Applications/Dilutions

Packaging, Storage & Formulations

Alternate Names for BPTF/FALZ Recombinant Protein Antigen

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for BPTF/FALZ Protein (NBP1-84756PEP) (0)

Reviews for BPTF/FALZ Protein (NBP1-84756PEP) (0)

FAQs for BPTF/FALZ Protein (NBP1-84756PEP). (Showing 1 - 1 of 1 FAQ).

Additional BPTF/FALZ Products

Blogs on BPTF/FALZ

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Molarity Calculator

Review this Product

Bioinformatics