![Western Blot: Borealin Antibody [NBP1-89951] - Aurora B preferentially binds to H3R2me2a and recruits CPC components. Lysates of TN-arrested Aurora B-depleted cells were supplemented with recombinant Survivin and Borealin proteins with or without recombinant Aurora B protein. The lysates were incubated with antibodies against INCENP and the H3R2me2a peptide, and pulldown was conducted with agarose A beads. The binding was visualized by immunoblotting. The asterisk denotes the light chain of antibodies. Image collected and cropped by CiteAb from the following publication (//www.nature.com/articles/s41467-020-14511-w), licensed under a CC-BY license.](http://images.novusbio.com/fullsize/Borealin-Antibody-Western-Blot-NBP1-89951-img0018.jpg "Western Blot: Borealin Antibody [NBP1-89951] - Aurora B preferentially binds to H3R2me2a and recruits CPC components. Lysates of TN-arrested Aurora B-depleted cells were supplemented with recombinant Survivin and Borealin proteins with or without recombinant Aurora B protein. The lysates were incubated with antibodies against INCENP and the H3R2me2a peptide, and pulldown was conducted with agarose A beads. The binding was visualized by immunoblotting. The asterisk denotes the light chain of antibodies. Image collected and cropped by CiteAb from the following publication (//www.nature.com/articles/s41467-020-14511-w), licensed under a CC-BY license.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: PLKSAKTRKVIQVDEMIVEEEEEEENERKNLQTARVKRCPPSKKRTQSIQGKGKGKRSSRANTVTPAVGRLEVSMVKPTPGLTPRFDSR |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CDCA8 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for Borealin Antibody (NBP1-89951)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | CDCA8 |
![Immunocytochemistry/Immunofluorescence: Borealin Antibody [NBP1-89951] - Staining of human cell line U-251 MG shows localization to nucleus & nucleoli. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/Borealin-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-89951-img0010.jpg "Immunocytochemistry/Immunofluorescence: Borealin Antibody [NBP1-89951] - Staining of human cell line U-251 MG shows localization to nucleus & nucleoli. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: Borealin Antibody [NBP1-89951] - Staining in human testis and skeletal muscle tissues using NBP1-89951 antibody. Corresponding CDCA8 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/Borealin-Antibody-Immunohistochemistry-Paraffin-NBP1-89951-img0016.jpg "Immunohistochemistry-Paraffin: Borealin Antibody [NBP1-89951] - Staining in human testis and skeletal muscle tissues using NBP1-89951 antibody. Corresponding CDCA8 RNA-seq data are presented for the same tissues.")
![Western Blot: Borealin Antibody [NBP1-89951] - Analysis in control (vector only transfected HEK293T lysate) and CDCA8 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/fullsize/Borealin-Antibody-Western-Blot-NBP1-89951-img0011.jpg "Western Blot: Borealin Antibody [NBP1-89951] - Analysis in control (vector only transfected HEK293T lysate) and CDCA8 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).")
![Western Blot: Borealin Antibody [NBP1-89951] - H3R2me2a acts as a histone mark for CPC recruitment on chromosome arms. The cytosol and chromosome fractions were isolated by centrifugation from mitotic HeLa cells treated with Haspin or a PRMT6 inhibitor and analyzed by Western blot probing for the indicated proteins. Histone H3 and tubulin served as loading controls for chromosome and cytosol fractions, respectively. Image collected and cropped by CiteAb from the following publication (//www.nature.com/articles/s41467-020-14511-w), licensed under a CC-BY license.](http://images.novusbio.com/fullsize/Borealin-Antibody-Western-Blot-NBP1-89951-img0017.jpg "Western Blot: Borealin Antibody [NBP1-89951] - H3R2me2a acts as a histone mark for CPC recruitment on chromosome arms. The cytosol and chromosome fractions were isolated by centrifugation from mitotic HeLa cells treated with Haspin or a PRMT6 inhibitor and analyzed by Western blot probing for the indicated proteins. Histone H3 and tubulin served as loading controls for chromosome and cytosol fractions, respectively. Image collected and cropped by CiteAb from the following publication (//www.nature.com/articles/s41467-020-14511-w), licensed under a CC-BY license.")
![Immunohistochemistry-Paraffin: Borealin Antibody [NBP1-89951] - Staining of human duodenum shows strong nuclear positivity in a subset of glandular cells.](http://images.novusbio.com/fullsize/Borealin-Antibody-Immunohistochemistry-Paraffin-NBP1-89951-img0012.jpg "Immunohistochemistry-Paraffin: Borealin Antibody [NBP1-89951] - Staining of human duodenum shows strong nuclear positivity in a subset of glandular cells.")
![Immunohistochemistry-Paraffin: Borealin Antibody [NBP1-89951] - Staining of human lymphoid tissues shows moderate nuclear positivity in germinal center cells.](http://images.novusbio.com/fullsize/Borealin-Antibody-Immunohistochemistry-Paraffin-NBP1-89951-img0013.jpg "Immunohistochemistry-Paraffin: Borealin Antibody [NBP1-89951] - Staining of human lymphoid tissues shows moderate nuclear positivity in germinal center cells.")
![Immunohistochemistry-Paraffin: Borealin Antibody [NBP1-89951] - Staining of human skeletal muscle shows no positivity in myocytes as expected.](http://images.novusbio.com/fullsize/Borealin-Antibody-Immunohistochemistry-Paraffin-NBP1-89951-img0014.jpg "Immunohistochemistry-Paraffin: Borealin Antibody [NBP1-89951] - Staining of human skeletal muscle shows no positivity in myocytes as expected.")
![Immunohistochemistry-Paraffin: Borealin Antibody [NBP1-89951] - Staining of human testis shows moderate to strong nuclear positivity in cells in seminiferous ducts.](http://images.novusbio.com/fullsize/Borealin-Antibody-Immunohistochemistry-Paraffin-NBP1-89951-img0015.jpg "Immunohistochemistry-Paraffin: Borealin Antibody [NBP1-89951] - Staining of human testis shows moderate to strong nuclear positivity in cells in seminiferous ducts.")
![Western Blot: Borealin Antibody [NBP1-89951] - Aurora B preferentially binds to H3R2me2a & recruits CPC components.a The amino acid sequences of modified histone H3 peptides. b In vitro Haspin kinase assay w/ 21-aa peptide. c In vitro Aurora B kinase assay w/ 21-aa peptide for phosphorylation. d In vitro PRMT6 methyltransferase assay. e–h The cells treated w/ siPRMT6, PRMT6 inhibitor MS023, or the Haspin kinase inhibitor CHR-6494. The intensities of H3R2me2a (f) & H3T3ph (h) in chromosome arm & centromere analyzed by IF microscopy of nocodazole-arrested HeLa chromosome spreads & plotted (n = 100 chromosomes from three independent experiments). i After transfection of indicated plasmids, HeLa cells treated w/ a Haspin kinase inhibitor, CHR-6494, for 5 h & the intensity of CPC components analyzed for 100 centromeres from three independent experiments. j Recombinant CPC proteins incubated w/ biotinylated histone peptides & pulled down w/ streptavidin-agarose beads, & the binding visualized by immunoblotting. k Lysates of TN-arrested Aurora B-depleted cells supplemented w/ recombinant Survivin & Borealin proteins w/ or w/out recombinant Aurora B protein. The lysates incubated w/ antibodies against INCENP & the H3R2me2a peptide, & pulldown conducted w/ agarose A beads. The binding visualized by immunoblotting. The asterisk denotes the light chain of antibodies. l Lysates of TN-arrested mitotic HeLa cells incubated w/ biotinylated histone peptides & pulled down w/ streptavidin-agarose beads, & the binding visualized by immunoblotting. Relative band intensities of band measured w/ image processing software (Image Studio ver5.0). Error bars, SEMs. Scale bars, 5 μm. Source data are provided as a Source Data file. (Student’s t-test *p < 0.01). Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/32001712), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp1-89951_rabbit-polyclonal-borealin-antibody-310202416113528.jpg "Western Blot: Borealin Antibody [NBP1-89951] - Aurora B preferentially binds to H3R2me2a & recruits CPC components.a The amino acid sequences of modified histone H3 peptides. b In vitro Haspin kinase assay w/ 21-aa peptide. c In vitro Aurora B kinase assay w/ 21-aa peptide for phosphorylation. d In vitro PRMT6 methyltransferase assay. e–h The cells treated w/ siPRMT6, PRMT6 inhibitor MS023, or the Haspin kinase inhibitor CHR-6494. The intensities of H3R2me2a (f) & H3T3ph (h) in chromosome arm & centromere analyzed by IF microscopy of nocodazole-arrested HeLa chromosome spreads & plotted (n = 100 chromosomes from three independent experiments). i After transfection of indicated plasmids, HeLa cells treated w/ a Haspin kinase inhibitor, CHR-6494, for 5 h & the intensity of CPC components analyzed for 100 centromeres from three independent experiments. j Recombinant CPC proteins incubated w/ biotinylated histone peptides & pulled down w/ streptavidin-agarose beads, & the binding visualized by immunoblotting. k Lysates of TN-arrested Aurora B-depleted cells supplemented w/ recombinant Survivin & Borealin proteins w/ or w/out recombinant Aurora B protein. The lysates incubated w/ antibodies against INCENP & the H3R2me2a peptide, & pulldown conducted w/ agarose A beads. The binding visualized by immunoblotting. The asterisk denotes the light chain of antibodies. l Lysates of TN-arrested mitotic HeLa cells incubated w/ biotinylated histone peptides & pulled down w/ streptavidin-agarose beads, & the binding visualized by immunoblotting. Relative band intensities of band measured w/ image processing software (Image Studio ver5.0). Error bars, SEMs. Scale bars, 5 μm. Source data are provided as a Source Data file. (Student’s t-test *p < 0.01). Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/32001712), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Western Blot: Borealin Antibody [NBP1-89951] - Aurora B preferentially binds to H3R2me2a & recruits CPC components.a The amino acid sequences of modified histone H3 peptides. b In vitro Haspin kinase assay w/ 21-aa peptide. c In vitro Aurora B kinase assay w/ 21-aa peptide for phosphorylation. d In vitro PRMT6 methyltransferase assay. e–h The cells treated w/ siPRMT6, PRMT6 inhibitor MS023, or the Haspin kinase inhibitor CHR-6494. The intensities of H3R2me2a (f) & H3T3ph (h) in chromosome arm & centromere analyzed by IF microscopy of nocodazole-arrested HeLa chromosome spreads & plotted (n = 100 chromosomes from three independent experiments). i After transfection of indicated plasmids, HeLa cells treated w/ a Haspin kinase inhibitor, CHR-6494, for 5 h & the intensity of CPC components analyzed for 100 centromeres from three independent experiments. j Recombinant CPC proteins incubated w/ biotinylated histone peptides & pulled down w/ streptavidin-agarose beads, & the binding visualized by immunoblotting. k Lysates of TN-arrested Aurora B-depleted cells supplemented w/ recombinant Survivin & Borealin proteins w/ or w/out recombinant Aurora B protein. The lysates incubated w/ antibodies against INCENP & the H3R2me2a peptide, & pulldown conducted w/ agarose A beads. The binding visualized by immunoblotting. The asterisk denotes the light chain of antibodies. l Lysates of TN-arrested mitotic HeLa cells incubated w/ biotinylated histone peptides & pulled down w/ streptavidin-agarose beads, & the binding visualized by immunoblotting. Relative band intensities of band measured w/ image processing software (Image Studio ver5.0). Error bars, SEMs. Scale bars, 5 μm. Source data are provided as a Source Data file. (Student’s t-test *p < 0.01). Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/32001712), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp1-89951_rabbit-polyclonal-borealin-antibody-310202416121943.jpg "Western Blot: Borealin Antibody [NBP1-89951] - Aurora B preferentially binds to H3R2me2a & recruits CPC components.a The amino acid sequences of modified histone H3 peptides. b In vitro Haspin kinase assay w/ 21-aa peptide. c In vitro Aurora B kinase assay w/ 21-aa peptide for phosphorylation. d In vitro PRMT6 methyltransferase assay. e–h The cells treated w/ siPRMT6, PRMT6 inhibitor MS023, or the Haspin kinase inhibitor CHR-6494. The intensities of H3R2me2a (f) & H3T3ph (h) in chromosome arm & centromere analyzed by IF microscopy of nocodazole-arrested HeLa chromosome spreads & plotted (n = 100 chromosomes from three independent experiments). i After transfection of indicated plasmids, HeLa cells treated w/ a Haspin kinase inhibitor, CHR-6494, for 5 h & the intensity of CPC components analyzed for 100 centromeres from three independent experiments. j Recombinant CPC proteins incubated w/ biotinylated histone peptides & pulled down w/ streptavidin-agarose beads, & the binding visualized by immunoblotting. k Lysates of TN-arrested Aurora B-depleted cells supplemented w/ recombinant Survivin & Borealin proteins w/ or w/out recombinant Aurora B protein. The lysates incubated w/ antibodies against INCENP & the H3R2me2a peptide, & pulldown conducted w/ agarose A beads. The binding visualized by immunoblotting. The asterisk denotes the light chain of antibodies. l Lysates of TN-arrested mitotic HeLa cells incubated w/ biotinylated histone peptides & pulled down w/ streptavidin-agarose beads, & the binding visualized by immunoblotting. Relative band intensities of band measured w/ image processing software (Image Studio ver5.0). Error bars, SEMs. Scale bars, 5 μm. Source data are provided as a Source Data file. (Student’s t-test *p < 0.01). Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/32001712), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")