![Western Blot: BMI-1 Antibody [NBP1-87321] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1,. Remaining relative intensity is presented. Loading control: Anti-PPIB.](http://images.novusbio.com/fullsize/BMI-1-Antibody-Western-Blot-NBP1-87321-img0009.jpg "Western Blot: BMI-1 Antibody [NBP1-87321] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1,. Remaining relative intensity is presented. Loading control: Anti-PPIB.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, IHC, KD |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: RPTCKRMKISHQRDGLTNAGELESDSGSDKANSPAGGIPSTSSCLPSPSTPVQSPHPQFPHISSTMNGTSNSPSGNHQSSFANRPRKSSVNGSSATSSG |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | BMI1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publication using NBP1-87321 | Applications | Species |
|---|---|---|
| Kwiatkowski E, Suman S, Kallakury BVS et al. Expression of Stem Cell Markers in High-LET Space Radiation-Induced Intestinal Tumors in Apc(1638N/+) Mouse Intestine Cancers (Basel) 2023-08-24 [PMID: 37686516] (Immunocytochemistry/ Immunofluorescence) | Immunocytochemistry/ Immunofluorescence |
Secondary Antibodies |
Isotype Controls |
Research Areas for BMI-1 Antibody (NBP1-87321)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | BMI1 |
![Immunohistochemistry-Paraffin: BMI-1 Antibody [NBP1-87321] - Staining of human cerebral cortex shows moderate nuclear positivity in glial cells.](http://images.novusbio.com/fullsize/BMI-1-Antibody-Immunohistochemistry-Paraffin-NBP1-87321-img0012.jpg "Immunohistochemistry-Paraffin: BMI-1 Antibody [NBP1-87321] - Staining of human cerebral cortex shows moderate nuclear positivity in glial cells.")
![Western Blot: BMI-1 Antibody [NBP1-87321] - Analysis in human cell line HDLM-2.](http://images.novusbio.com/fullsize/BMI-1-Antibody-Western-Blot-NBP1-87321-img0007.jpg "Western Blot: BMI-1 Antibody [NBP1-87321] - Analysis in human cell line HDLM-2.")
![Western Blot: BMI-1 Antibody [NBP1-87321] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.](http://images.novusbio.com/fullsize/BMI-1-Antibody-Western-Blot-NBP1-87321-img0008.jpg "Western Blot: BMI-1 Antibody [NBP1-87321] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.")
![Immunohistochemistry-Paraffin: BMI-1 Antibody [NBP1-87321] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.](http://images.novusbio.com/fullsize/BMI-1-Antibody-Immunohistochemistry-Paraffin-NBP1-87321-img0010.jpg "Immunohistochemistry-Paraffin: BMI-1 Antibody [NBP1-87321] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.")
![Immunohistochemistry-Paraffin: BMI-1 Antibody [NBP1-87321] - Staining of human prostate shows moderate nuclear positivity in glandular cells.](http://images.novusbio.com/fullsize/BMI-1-Antibody-Immunohistochemistry-Paraffin-NBP1-87321-img0011.jpg "Immunohistochemistry-Paraffin: BMI-1 Antibody [NBP1-87321] - Staining of human prostate shows moderate nuclear positivity in glandular cells.")
![Immunohistochemistry-Paraffin: BMI-1 Antibody [NBP1-87321] - Staining of human placenta shows moderate nuclear positivity in trophoblastic cells.](http://images.novusbio.com/fullsize/BMI-1-Antibody-Immunohistochemistry-Paraffin-NBP1-87321-img0013.jpg "Immunohistochemistry-Paraffin: BMI-1 Antibody [NBP1-87321] - Staining of human placenta shows moderate nuclear positivity in trophoblastic cells.")
![Western Blot EZH2/KMT6 Antibody [Unconjugated]](https://images.novusbio.com/images2/EZH2_AF4767_Western_Blot_12571.jpg)
![Western Blot EZH2/KMT6 Antibody [Unconjugated]](https://images.novusbio.com/images/af4767_human-mouse-ezh2-affinity-purified-polyclonal-ab-4120241240516.jpg)
![Western Blot EZH2/KMT6 Antibody [Unconjugated]](https://images.novusbio.com/images/af4767_human-mouse-ezh2-affinity-purified-polyclonal-ab-4120241240219.jpg)
![Chromatin Immunoprecipitation (ChIP) Oct-3/4 Antibody [Unconjugated]](https://images.novusbio.com/images2/Oct-3_4_AF1759_Chromatin_Immunoprecipitation_11218.jpg)
![Immunocytochemistry Oct-3/4 Antibody [Unconjugated]](https://images.novusbio.com/images2/Oct-3_4_AF1759_Immunocytochemistry_7093.jpg)
![Simple Western Oct-3/4 Antibody [Unconjugated]](https://images.novusbio.com/images2/Oct3_4_AF1759_Simple_Western_20183.jpg)
![Bioactivity CTLA-4 [Unconjugated]](https://images.novusbio.com/images2/CTLA4_7268CT_2293.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")