BMAL1 Antibody (4F5N3) Summary
Additional Information |
Recombinant Monoclonal Antibody |
Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 500-600 of human BMAL1 (O00327). AEEIMEIHRIRGSSPSSCGSSPLNITSTPPPDASSPGGKKILNGGTPDIPSSGLLSGQAQENPGYPYSDSSSILGENPHIGIDMIDNDQGSSSPSNDEAAM |
Isotype |
IgG |
Clonality |
Monoclonal |
Host |
Rabbit |
Gene |
BMAL1 |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Western Blot 1:500 - 1:1000
|
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles. |
Buffer |
PBS, 0.05% BSA, 50% glycerol, pH7.3 |
Preservative |
0.02% Sodium Azide |
Purity |
Affinity purified |
Alternate Names for BMAL1 Antibody (4F5N3)
Background
Aryl hydrocarbon receptor nuclear translocator-like (ARNTL), also known as Bmal1 or Mop3 is a major component of the circadian clock oscillator. Specifically, BMAL-1 acts as a general dimerization partner for a subset of the bHLH-PAS (basic-helix-loop-helix-PER-ARNT-SIM) superfamily of transcription regulators, is involved in circadian rhythm generation. BMAL 1 interacts with MOP4, CLOCK, Hypoxia-inducible factor-1 alpha and -2 alpha. This interaction appears to be distinct from that of the more characterized general partner, ARNT (HIF-1Beta).
BMAL1 is highly expressed in the adult brain, skeletal muscle and heart, and has been associated with hypertension and type 2 diabetes. Because of its role in the circadian clock oscillator, BMAL-1 is also thought to be invloven seasonal affective disorder. Therefore, BMAL1 antibodies are useful for circadian studies as well as heart and brain research.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Bv, Ca, Eq, Hu, Mu, Pm
Applications: IB, IHC, IHC-P, KO, WB
Species: Hu, Mu
Applications: ChIP, WB
Species: Hu, Mu, Rt
Applications: DB, ELISA, IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: ICC, IHC, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Ca, Fe, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Ha, Hu, Mu, Rb, Rt
Applications: ICC/IF, IHC, IHC-P, IP, MiAr, WB
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Eq, Hu, Mu, Rt
Applications: IHC, IHC-P, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ChIP, CHIP-SEQ, ChIP, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP, KD, Simple Western, WB
Species: Hu, Mu, Rt
Applications: WB
Publications for BMAL1 Antibody (NBP3-16467) (0)
There are no publications for BMAL1 Antibody (NBP3-16467).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for BMAL1 Antibody (NBP3-16467) (0)
There are no reviews for BMAL1 Antibody (NBP3-16467).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for BMAL1 Antibody (NBP3-16467) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional BMAL1 Products
Research Areas for BMAL1 Antibody (NBP3-16467)
Find related products by research area.
|
Blogs on BMAL1