Home » Biglycan » Biglycan Proteins » Biglycan Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

Biglycan Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for Biglycan Protein (NBP1-84971PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Biglycan Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human BGN.

Source: E. coli

Amino Acid Sequence: RGFWDFTLDDGPFMMNDEEASGADTSGVLDPDSVTPTYSAMCPFGCHCHLRVVQCSDLGLKSVPKEISPDTTLLDLQNNDISELRKDDFKGLQHLYALVLVNNKISKIHEKAFSPLRKLQKLYISKNHLVEIPPNLPSSL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
BGN
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84971.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Biglycan Recombinant Protein Antigen

  • BGN
  • Biglycan
  • Bone/cartilage proteoglycan I
  • bone/cartilage proteoglycan-I
  • dermatan sulphate proteoglycan I
  • DSPG1
  • PGI
  • PG-S1
  • SLRR1A
  • SLRR1Abiglycan proteoglycan
  • small leucine-rich protein 1A

Background

Biglycan is encoded by this gene is a small cellular or pericellular matrix proteoglycan that is closely related in structure to two other small proteoglycans, decorin and fibromodulin. The encoded protein and decorin are thought to be the result of a gene duplication. Decorin contains one attached glycosaminoglycan chain, while this protein probably contains two chains. For this reason, this protein is called biglycan. This protein is thought to function in connective tissue metabolism by binding to collagen fibrils and transfering growth factor-beta. It may promote neuronal survival. This gene is a candidate gene for the Happle syndrome.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Decorin Antibody
[Unconjugated]
AF143
Western Blot Decorin Antibody [Unconjugated]
Simple Western Decorin Antibody [Unconjugated]
Immunohistochemistry Decorin Antibody [Unconjugated]
(29 Publications)
Species: Hu
Applications: IHC, Simple Western, WB
Glucose 6
phosphate isomerase A ...
NBP2-02541
Western Blot Glucose 6 phosphate isomerase Antibody (OTI2D2)
Immunohistochemistry-Paraffin Glucose 6 phosphate isomerase Antibody (OTI2D2)
Immunohistochemistry-Paraffin Glucose 6 phosphate isomerase Antibody (OTI2D2)
(1 Publication)
Species: Hu, Pm, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
COX-2 Antibody
NB100-689
Immunohistochemistry-Paraffin COX-2 Antibody
Simple Western COX-2 Antibody
(1 Review)
(36 Publications)
Species: Hu, Rt
Applications: IHC, IHC-Fr, IHC-P, Simple Western, WB
Versican Antibody
[Unconjugated] - Isof ...
AF3054
Immunocytochemistry Versican Antibody [Unconjugated] - Isoform V0
Immunocytochemistry Versican Antibody [Unconjugated] - Isoform V0
Immunocytochemistry/ Immunofluorescence Versican Antibody [Unconjugated] - Isoform V0
(8 Publications)
Species: Hu
Applications: ICC, IHC, WB
Fibromodulin/FMOD
Antibody
AF5945
Western Blot Fibromodulin/FMOD Antibody
Species: Hu, Mu, Rt
Applications: WB
CPOX Antibody
(36B10) - BSA Free
NBP2-59438
Immunocytochemistry/ Immunofluorescence CPOX Antibody (36B10) - BSA Free
Western Blot CPOX Antibody (36B10) - BSA Free
(1 Publication)
Species: Hu
Applications: ELISA, ICC/IF, WB
Recombinant Human
COX8A GST (N-Term) Pr ...
H00001351-P01
SDS-PAGE Recombinant Human COX8A GST (N-Term) Protein
Species: Hu
Applications: ELISA, AP, PA, WB
COX5A Antibody
NBP1-32550
Western Blot COX5A Antibody
Immunohistochemistry-Paraffin COX5A Antibody
Western Blot COX5A Antibody
(3 Publications)
Species: Hu, Mu, Ze
Applications: ICC/IF, IHC, IHC-P, WB
PLGF [HRP]
DPG00
N/A PLGF [HRP]
N/A PLGF [HRP]
N/A PLGF [HRP]
(79 Publications)
Species: Hu
Applications: ELISA
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(817 Publications)
Species: Hu
Applications: BA
COX-1 Antibody
NBP1-85500
Immunocytochemistry/ Immunofluorescence COX-1 Antibody
Immunohistochemistry-Paraffin COX-1 Antibody
Immunohistochemistry-Paraffin COX-1 Antibody
(1 Review)
(3 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Pepsinogen
C/PGC/Progastricsin A
NBP1-91011
Western Blot Pepsinogen C/PGC/Progastricsin Antibody
Western Blot Pepsinogen C/PGC/Progastricsin Antibody
Immunohistochemistry-Paraffin Pepsinogen C/PGC/Progastricsin Antibody
(1 Publication)
Species: Hu
Applications: IHC, IHC-Fr, IHC-P, WB
Aggrecan
Neoepitope Antibody -
NB100-74350
Western Blot Aggrecan Neoepitope Antibody - BSA Free
Western Blot Aggrecan Neoepitope Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence Aggrecan Neoepitope Antibody - BSA Free
(32 Publications)
Species: Bv, Ca, Hu, Mu, Po, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
PGD Antibody
NBP1-31589
Western Blot PGD Antibody
Immunohistochemistry-Paraffin PGD Antibody
Immunocytochemistry/ Immunofluorescence PGD Antibody
(4 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Prostaglandin I2
Synthase Antibody (85 ...
MAB7788
Simple Western Prostaglandin I2 Synthase Antibody (852307) [Unconjugated]
Western Blot Prostaglandin I2 Synthase Antibody (852307) [Unconjugated]
(1 Publication)
Species: Hu
Applications: Simple Western, WB
PHGDH Antibody
NBP1-87311
Western Blot PHGDH Antibody
Western Blot PHGDH Antibody
Simple Western PHGDH Antibody
(7 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB

Publications for Biglycan Protein (NBP1-84971PEP) (0)

There are no publications for Biglycan Protein (NBP1-84971PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Biglycan Protein (NBP1-84971PEP) (0)

There are no reviews for Biglycan Protein (NBP1-84971PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Biglycan Protein (NBP1-84971PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Biglycan Products

Research Areas for Biglycan Protein (NBP1-84971PEP)

Find related products by research area.

Blogs on Biglycan

There are no specific blogs for Biglycan, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Biglycan Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol BGN