![Immunohistochemistry-Paraffin: Bestrophin 4 Antibody [NBP2-34214] - Staining of human duodenum shows strong membranous positivity in glandular cells.](http://images.novusbio.com/fullsize/antibody/nbp2-34214_rabbit-polyclonal-bestrophin-4-antibody-immunohistochemistry-paraffin-248202383610..jpg "Immunohistochemistry-Paraffin: Bestrophin 4 Antibody [NBP2-34214] - Staining of human duodenum shows strong membranous positivity in glandular cells.")
| Reactivity | HuSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: LVGRQFVEPEAGAAKPQKLLKPGQEPAPALGDPDM |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | BEST4 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
|
"I can see clearly now": Targeting Bestrophin 1 to treat Bestrophinopathies Encoded by the VMD2 gene on chromosome 11q13 Bestrophin 1 is the prototypic member of the RFP family of proteins which are more commonly called "bestrophins". The protein family was originally identified in Caenorhabditis elegans based on a conserved ... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: Bestrophin 4 Antibody [NBP2-34214] -Staining of human tonsil shows moderate membranous positivity in squamous epithelial cells.](http://images.novusbio.com/fullsize/antibody/nbp2-34214_rabbit-polyclonal-bestrophin-4-antibody-immunohistochemistry-paraffin-248202383724..jpg "Immunohistochemistry-Paraffin: Bestrophin 4 Antibody [NBP2-34214] -Staining of human tonsil shows moderate membranous positivity in squamous epithelial cells.")
![Immunohistochemistry-Paraffin: Bestrophin 4 Antibody [NBP2-34214] -Staining of human lung cancer shows moderate membranous positivity in tumor cells.](http://images.novusbio.com/fullsize/antibody/nbp2-34214_rabbit-polyclonal-bestrophin-4-antibody-immunohistochemistry-paraffin-248202383834..jpg "Immunohistochemistry-Paraffin: Bestrophin 4 Antibody [NBP2-34214] -Staining of human lung cancer shows moderate membranous positivity in tumor cells.")
![Immunohistochemistry-Paraffin: Bestrophin 4 Antibody [NBP2-34214] - Staining of human liver shows no positivity in hepatocytes as expected.](http://images.novusbio.com/fullsize/antibody/nbp2-34214_rabbit-polyclonal-bestrophin-4-antibody-immunohistochemistry-paraffin-248202384226..jpg "Immunohistochemistry-Paraffin: Bestrophin 4 Antibody [NBP2-34214] - Staining of human liver shows no positivity in hepatocytes as expected.")
![Immunocytochemistry Integrin alpha 2/CD49b Antibody (HAS3) [Unconjugated]](https://images.novusbio.com/images2/Integrin_alpha_2_MAB1233_Immunocytochemistry__Immunofluorescence_19196.jpg)
![Flow Cytometry Integrin alpha 2/CD49b Antibody (HAS3) [Unconjugated]](https://images.novusbio.com/images2/Integrin_alpha_2_MAB1233_Flow_Cytometry_19476.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")