![Immunohistochemistry-Paraffin: Bcl-6 Antibody [NBP2-59786] - Staining in human tonsil and pancreas tissues . Corresponding BCL6 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/Bcl-6-Antibody-Immunohistochemistry-Paraffin-NBP2-59786-img0005.jpg "Immunohistochemistry-Paraffin: Bcl-6 Antibody [NBP2-59786] - Staining in human tonsil and pancreas tissues . Corresponding BCL6 RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the amino acid sequence: NIYSPKETIPEEARSDMHYSVAEGLKPAAPSARNAPYFPCDKASKEEERPSSEDEIALHFEPPNAPLNRKGLVSPQSPQKSDCQPNSPTESCSSKNACILQASGSPPAKSPTDPKACNWKKYKFIVLNS |
| Predicted Species | Mouse (95%), Rat (94%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | BCL6 |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Protein A purified |
![Immunohistochemistry CD3 Antibody (17A2) [Unconjugated]](https://images.novusbio.com/images2/CD3_MAB4841_Immunohistochemistry_7033.jpg)
![Immunocytochemistry CD3 Antibody (17A2) [Unconjugated]](https://images.novusbio.com/images2/CD3_MAB4841_Immunocytochemistry__Immunofluorescence_23528.jpg)
![Immunohistochemistry CD3 Antibody (17A2) [Unconjugated]](https://images.novusbio.com/images/antibody/mab4841_mouse-cd3-mab-clone-17a2-immunohistochemistry-88202312119.jpg)
| Publication using NBP2-59786 | Applications | Species |
|---|---|---|
| Burda JE, O'Shea TM, Ao Y et al. Divergent transcriptional regulation of astrocyte reactivity across disorders Nature 2022-05-25 [PMID: 35614216] (IHC-Fr, Mouse) | IHC-Fr | Mouse |
Secondary Antibodies |
Isotype Controls |
Research Areas for Bcl-6 Antibody (NBP2-59786)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | BCL6 |
![Immunocytochemistry/Immunofluorescence: Bcl-6 Antibody [NBP2-59786] - Human cell line U-251 MG shows localization to nucleoplasm. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/Bcl-6-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-59786-img0006.jpg "Immunocytochemistry/Immunofluorescence: Bcl-6 Antibody [NBP2-59786] - Human cell line U-251 MG shows localization to nucleoplasm. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: Bcl-6 Antibody [NBP2-59786] - Staining of human lymphoma, non-Hodgkin's type, shows strong nuclear positivity in tumor cells.](http://images.novusbio.com/fullsize/Bcl-6-Antibody-Immunohistochemistry-Paraffin-NBP2-59786-img0007.jpg "Immunohistochemistry-Paraffin: Bcl-6 Antibody [NBP2-59786] - Staining of human lymphoma, non-Hodgkin's type, shows strong nuclear positivity in tumor cells.")
![Immunohistochemistry-Paraffin: Bcl-6 Antibody [NBP2-59786] - Human tonsil shows strong nuclear positivity in germinal center cells.](http://images.novusbio.com/fullsize/Bcl-6-Antibody-Immunohistochemistry-NBP2-59786-img0001.jpg "Immunohistochemistry-Paraffin: Bcl-6 Antibody [NBP2-59786] - Human tonsil shows strong nuclear positivity in germinal center cells.")
![Immunohistochemistry-Paraffin: Bcl-6 Antibody [NBP2-59786] - Human lymph node shows strong nuclear positivity in germinal center cells.](http://images.novusbio.com/fullsize/Bcl-6-Antibody-Immunohistochemistry-NBP2-59786-img0002.jpg "Immunohistochemistry-Paraffin: Bcl-6 Antibody [NBP2-59786] - Human lymph node shows strong nuclear positivity in germinal center cells.")
![Immunohistochemistry-Paraffin: Bcl-6 Antibody [NBP2-59786] - Human pancreas shows no positivity as expected.](http://images.novusbio.com/fullsize/Bcl-6-Antibody-Immunohistochemistry-NBP2-59786-img0003.jpg "Immunohistochemistry-Paraffin: Bcl-6 Antibody [NBP2-59786] - Human pancreas shows no positivity as expected.")
![Immunohistochemistry-Paraffin: Bcl-6 Antibody [NBP2-59786] - Staining of human testis shows moderate to strong nuclear positivity in cells in seminiferous ducts.](http://images.novusbio.com/fullsize/Bcl-6-Antibody-Immunohistochemistry-Paraffin-NBP2-59786-img0008.jpg "Immunohistochemistry-Paraffin: Bcl-6 Antibody [NBP2-59786] - Staining of human testis shows moderate to strong nuclear positivity in cells in seminiferous ducts.")
![Immunohistochemistry Neprilysin/CD10 Antibody [Unconjugated]](https://images.novusbio.com/images2/Neprilysin_AF1126_Immunohistochemistry_6679.jpg)
![Western Blot Neprilysin/CD10 Antibody [Unconjugated]](https://images.novusbio.com/images/af1126_mouse-neprilysin-affinity-purified-polyclonal-ab-8220249505976.jpg)
![Western Blot Neprilysin/CD10 Antibody [Unconjugated]](https://images.novusbio.com/images/af1126_mouse-neprilysin-affinity-purified-polyclonal-ab-44202415433122.jpg)
![Immunocytochemistry IL-21 Antibody [Unconjugated]](https://images.novusbio.com/images2/IL-21_AF594_Immunocytochemistry_6525.jpg)
![Neutralization IL-21 Antibody [Unconjugated]](https://images.novusbio.com/images2/af594_mouse-il-21-affinity-purified-polyclonal-ab-neutralization-249202192915.jpg)
![Bioactivity CTLA-4 [Unconjugated]](https://images.novusbio.com/images2/CTLA4_7268CT_2293.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")