![Western Blot: BACE-1 Antibody [NBP1-62416] - Human Fetal Liver. Lane A: Primary Antibody. Lane B: Primary Antibody + Blocking Peptide.](http://images.novusbio.com/fullsize/BACE-1-Antibody-Western-Blot-NBP1-62416-img0017.jpg "Western Blot: BACE-1 Antibody [NBP1-62416] - Human Fetal Liver. Lane A: Primary Antibody. Lane B: Primary Antibody + Blocking Peptide.")
| Reactivity | Hu, MuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Concentration | 0.5 mg/ml |
| Description | The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution. |
| Immunogen | Synthetic peptides corresponding to BACE1/beta-secretase 1 (beta-site APP-cleaving enzyme 1) The peptide sequence was selected from the N terminal of BACE1/beta-secretase 1 (NP_036236). Peptide sequence GQGYYVEMTVGSPPQTLNILVDTGSSNFAVGAAPHPFLHRYYQRQLSSTY. The peptide sequence for this immunogen was taken from within the described region. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | BACE1 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Theoretical MW | 51 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Concentration | 0.5 mg/ml |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for BACE-1 Antibody (NBP1-62416)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry/Immunofluorescence: BACE-1 Antibody [NBP1-62416] - Mouse astrocytes (red fluorescence). Nuclei were stained with DAPI (blue fluorescence).](http://images.novusbio.com/fullsize/BACE-1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-62416-img0012.jpg "Immunocytochemistry/Immunofluorescence: BACE-1 Antibody [NBP1-62416] - Mouse astrocytes (red fluorescence). Nuclei were stained with DAPI (blue fluorescence).")
![Immunohistochemistry-Paraffin: BACE-1 Antibody [NBP1-62416] - Human testis tissue at an antibody concentration of 4-8ug/ml.](http://images.novusbio.com/fullsize/BACE-1-Antibody-Immunohistochemistry-Paraffin-NBP1-62416-img0014.jpg "Immunohistochemistry-Paraffin: BACE-1 Antibody [NBP1-62416] - Human testis tissue at an antibody concentration of 4-8ug/ml.")
![Western Blot: BACE-1 Antibody [NBP1-62416] - Sample Tissue: Human Fetal Liver, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1ug/ml, Peptide Concentration: 5ug/ml, Lysate Quantity: 25ug/lane/lane](http://images.novusbio.com/fullsize/BACE-1-Antibody-Western-Blot-NBP1-62416-img0011.jpg "Western Blot: BACE-1 Antibody [NBP1-62416] - Sample Tissue: Human Fetal Liver, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1ug/ml, Peptide Concentration: 5ug/ml, Lysate Quantity: 25ug/lane/lane")
![Western Blot: BACE-1 Antibody [NBP1-62416] - Astrocytes, Antibody Titration: 0.2-1 ug/ml](http://images.novusbio.com/fullsize/BACE-1-Antibody-Western-Blot-NBP1-62416-img0015.jpg "Western Blot: BACE-1 Antibody [NBP1-62416] - Astrocytes, Antibody Titration: 0.2-1 ug/ml")
![Western Blot: BACE-1 Antibody [NBP1-62416] - Mouse WT brain and Rat brain, concentration 2ug/ml.](http://images.novusbio.com/fullsize/BACE-1-Antibody-Western-Blot-NBP1-62416-img0016.jpg "Western Blot: BACE-1 Antibody [NBP1-62416] - Mouse WT brain and Rat brain, concentration 2ug/ml.")
![Immunohistochemistry-Paraffin: BACE-1 Antibody [NBP1-62416] - Human adrenal tissue at an antibody concentration of 4-8ug/ml.](http://images.novusbio.com/fullsize/BACE-1-Antibody-Immunohistochemistry-Paraffin-NBP1-62416-img0013.jpg "Immunohistochemistry-Paraffin: BACE-1 Antibody [NBP1-62416] - Human adrenal tissue at an antibody concentration of 4-8ug/ml.")
![ADAM10 [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "ADAM10 [Unconjugated]")
![Bioactivity GM-CSF [Unconjugated]](https://images.novusbio.com/images/protein/7954-gmcf_recombinant-human-gm-csf-cho-expressed-protein-cf-bioactivity-272020121514.jpg)
![Immunohistochemistry Neprilysin/CD10 Antibody [Unconjugated]](https://images.novusbio.com/images2/Neprilysin_AF1126_Immunohistochemistry_6679.jpg)
![Western Blot Neprilysin/CD10 Antibody [Unconjugated]](https://images.novusbio.com/images/af1126_mouse-neprilysin-affinity-purified-polyclonal-ab-8220249505976.jpg)
![Western Blot Neprilysin/CD10 Antibody [Unconjugated]](https://images.novusbio.com/images/af1126_mouse-neprilysin-affinity-purified-polyclonal-ab-44202415433122.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")