Home » ATP6V1G1 » ATP6V1G1 Proteins » ATP6V1G1 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

ATP6V1G1 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for ATP6V1G1 Recombinant Protein Antigen (NBP2-55232PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

ATP6V1G1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to ATP6V1G1.

Source: E. coli

Amino Acid Sequence: AEIEQYRLQREKEFKAKEAAALGSRGSCSTEVEKETQEKMTILQTYFRQNRDEVLDNLLAFVCDIRPEIHENYR

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ATP6V1G1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55232.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking tide related information and a protocol, click here.
Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ATP6V1G1 Recombinant Protein Antigen

  • ATP6G1V-ATPase 13 kDa subunit 1
  • ATP6GATP6J
  • ATP6GL
  • ATPase, H+ transporting, lysosomal (vacuolar proton pump), member J
  • ATPase, H+ transporting, lysosomal 13kDa, V1 subunit G isoform 1
  • ATPase, H+ transporting, lysosomal 13kDa, V1 subunit G1
  • DKFZp547P234
  • vacuolar ATP synthase subunit M16
  • vacuolar H(+)-ATPase subunit G 1
  • Vacuolar proton pump subunit G 1
  • Vacuolar proton pump subunit M16
  • V-ATPase subunit G 1
  • Vma10
  • V-type proton ATPase subunit G 1

Background

ATP6V1G1 is a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(809 Publications)
Species: Hu
Applications: BA
ATP6V0A1 Antibody
NBP1-89342
Immunocytochemistry/ Immunofluorescence ATP6V0A1 Antibody
Immunohistochemistry-Paraffin ATP6V0A1 Antibody
Immunohistochemistry-Paraffin ATP6V0A1 Antibody
(1 Review)
(13 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NFKBIL1 Antibody
NBP1-70344
Western Blot NFKBIL1 Antibody
Species: Am, Bv, Ca, Pm, Eq, Hu, Pm
Applications: WB
UAP56 Antibody
(2F5G7) - BSA Free
NBP2-52455
Western Blot UAP56 Antibody (2F5G7) - BSA Free
Western Blot UAP56 Antibody (2F5G7) - BSA Free
ELISA UAP56 Antibody (2F5G7) - BSA Free
Species: Hu, Mu
Applications: CyTOF-ready, ELISA, ICC/IF, IHC, IHC-P, WB
DDX39 Antibody
NBP2-16134
Western Blot DDX39 Antibody
Western Blot DDX39 Antibody
Immunoprecipitation DDX39 Antibody
(1 Review)
Species: Hu
Applications: IHC, IHC-P, IP, WB
ATP6V0A4 Antibody
NBP1-89330
Immunohistochemistry-Paraffin ATP6V0A4 Antibody
Immunohistochemistry-Paraffin ATP6V0A4 Antibody
Immunohistochemistry-Paraffin ATP6V0A4 Antibody
Species: Hu
Applications: IHC, IHC-P
SLC7A9 Antibody -
Azide and BSA Free
NBP2-93638
Immunohistochemistry SLC7A9 Antibody - Azide and BSA Free
Immunohistochemistry SLC7A9 Antibody - Azide and BSA Free
Western Blot SLC7A9 Antibody - Azide and BSA Free
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
ATP6V0A2 Antibody
NBP1-59069
Western Blot ATP6V0A2 Antibody
Western Blot ATP6V0A2 Antibody
Immunohistochemistry-Paraffin ATP6V0A2 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
MHC Class I
Antibody (OX18) - BSA
NB120-6405
Flow Cytometry MHC Class I Antibody (OX18) - BSA Free
Immunocytochemistry/ Immunofluorescence MHC Class I Antibody (OX18) - BSA Free
Immunocytochemistry/ Immunofluorescence MHC Class I Antibody (OX18) - BSA Free
(33 Publications)
Species: Rt
Applications: B/N, CyTOF-ready, EM, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Recombinant Human
HLA DRB4 GST (N-Term) ...
H00003126-P01
Other Recombinant Human HLA DRB4 GST (N-Term) Protein
(1 Publication)
Species: Hu
Applications: ELISA, AP, PA, WB
ATP6V1E2 Antibody
NBP2-49059
Immunohistochemistry-Paraffin ATP6V1E2 Antibody
Western Blot ATP6V1E2 Antibody
Species: Hu
Applications: IHC, IHC-P, WB
ATP6V1H Antibody
NBP1-32980
Immunohistochemistry-Paraffin ATP6V1H Antibody
Western Blot ATP6V1H Antibody
Immunohistochemistry-Paraffin ATP6V1H Antibody
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC-WhMt, IHC, IHC-P, WB
TCIRG1 Antibody
(6H3)
H00010312-M01
Western Blot TCIRG1 Antibody (6H3)
(5 Publications)
Species: Hu, Mu
Applications: ELISA, IHC, IHC-Fr, WB
MICB Antibody
(236511) [Unconjugate
MAB1599
Knockout Validated MICB Antibody (236511) [Unconjugated]
Flow Cytometry MICB Antibody (236511) [Unconjugated]
Flow Cytometry MICB Antibody (236511) [Unconjugated]
(47 Publications)
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, KO, WB
hnRNP C1 + C2
Antibody (CL2593)
NBP2-36776
Western Blot hnRNP C1 + C2 Antibody (CL2593)
Immunohistochemistry hnRNP C1 + C2 Antibody (CL2593)
Immunohistochemistry hnRNP C1 + C2 Antibody (CL2593)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB

Lymphotoxin-alpha/TNF- ...
211-TBB/CF
SDS-PAGE Lymphotoxin-alpha/TNF-beta [Unconjugated]
Bioactivity Lymphotoxin-alpha/TNF-beta [Unconjugated]
(8 Publications)
Species: Hu
Applications: BA
ATP6V1E1 Antibody
NBP2-15520
Western Blot ATP6V1E1 Antibody
Immunohistochemistry-Paraffin ATP6V1E1 Antibody
Immunohistochemistry-Paraffin ATP6V1E1 Antibody
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
ATP6V1C1 Antibody
NBP2-58586
Western Blot ATP6V1C1 Antibody
Immunocytochemistry/ Immunofluorescence ATP6V1C1 Antibody
Species: Hu
Applications: ICC/IF, WB
PLEKHM1 Antibody
NBP2-38449
Immunohistochemistry-Paraffin PLEKHM1 Antibody
Immunohistochemistry-Paraffin PLEKHM1 Antibody
Immunohistochemistry-Paraffin PLEKHM1 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P
ATP6V1G1
Recombinant Protein A
NBP2-55232PEP
ATP6V1G1 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for ATP6V1G1 Recombinant Protein Antigen (NBP2-55232PEP) (0)

There are no publications for ATP6V1G1 Recombinant Protein Antigen (NBP2-55232PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ATP6V1G1 Recombinant Protein Antigen (NBP2-55232PEP) (0)

There are no reviews for ATP6V1G1 Recombinant Protein Antigen (NBP2-55232PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ATP6V1G1 Recombinant Protein Antigen (NBP2-55232PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ATP6V1G1 Products

Blogs on ATP6V1G1

There are no specific blogs for ATP6V1G1, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ATP6V1G1 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol ATP6V1G1