Novus Biologicals products are now on bio-techne.com

Recombinant Human ATG4A GST (N-Term) Protein

Images

 
SDS-Page: ATG4A Recombinant Protein [H00115201-P01]

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, AP

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Recombinant Human ATG4A GST (N-Term) Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-398 of Human ATG4A

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MESVLSKYEDQITIFTDYLEEYPDTDELVWILGKQHLLKTEKSKLLSDISARLWFTYRRKFSPIGGTGPSSDAGWGCMLRCGQMMLAQALICRHLGRDWSWEKQKEQPKEYQRILQCFLDRKDCCYSIHQMAQMGVGEGKSIGEWFGPNTVAQVLKKLALFDEWNSLAVYVSMDNTVVIEDIKKMCRVLPLSADTAGDRPPDSLTASNQSKGTSAYCSAWKPLLLIVPLRLGINQINPVYVDAFKECFKMPQSLGALGGKPNNAYYFIGFLGDELIFLDPHTTQTFVDTEENGTVNDQTFHCLQSPQRMNILNLDPSVALGFFCKEEKDFDNWCSLVQKEILKENLRMFELVQKHPSHWPPFVPPAKPEVTTTGAEFIDSTEQLEEFDLEEDFEILSV

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
ATG4A
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
71.8 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ATG4A GST (N-Term) Protein

  • APG4 autophagy 4 homolog A (S. cerevisiae)
  • Apg4a
  • ATG4 autophagy related 4 homolog A (S. cerevisiae)
  • ATG4A
  • Atg4al
  • Autl2
  • AUT-like 2 cysteine endopeptidase
  • AUT-like 2, cysteine endopeptidase (S. cerevisiae)
  • Autophagin 2
  • autophagin-2
  • cysteine endopeptidase
  • cysteine protease ATG4A
  • EC 3.4.22
  • EC 3.4.22.-
  • hAPG4A

Background

Autophagy is the process by which endogenous proteins and damaged organelles are destroyed intracellularly. Autophagy is postulated to be essential for cell homeostasis and cell remodeling during differentiation, metamorphosis, non-apoptotic cell death, and aging. Reduced levels of autophagy have been described in some malignant tumors, and a role for autophagy in controlling the unregulated cell growth linked to cancer has been proposed. This gene encodes a member of the autophagin protein family. The encoded protein is also designated as a member of the C-54 family of cysteine proteases. Transcript variants that encode distinct isoforms have been identified.; FUNCTION: Cysteine protease required for autophagy, which cleaves the C-terminal part of either MAP1LC3, GABARAPL2 or GABARAP, allowing the liberation of form I. A subpopulation of form I is subsequently converted to a smaller form (form II). Form II, with a revealed C-terminal glycine, is considered to be the phosphatidylethanolamine (PE)-conjugated form, and has the capacity for the binding to autophagosomes.; ENZYME REGULATION: Inhibited by N-ethylmaleimide; SUBCELLULAR LOCATION: Cytoplasm;

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-82090
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP2-41307
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP1-55202
Species: Hu
Applications: IHC, IHC-P, WB
NB100-2331
Species: Am, Ca, Fi, Hu, Mu, Pl, Rt, Ze
Applications: ChIP, ChIP, ELISA, Flow, IB, ICC/IF, IHC-WhMt, IHC, IHC-Fr, IHC-P, IP, Simple Western, SB, WB
NB500-249
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, Simple Western, WB
NBP1-71771
Species: Dr, Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
AF1916
Species: Hu
Applications: ICC, IHC, WB
NBP2-81954
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP2-41217
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP1-18885
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, KO, WB
AF8216
Species: Hu, Mu, Rt
Applications: WB
AF1759
Species: Hu, Mu
Applications: ChIP, ICC, IP, Simple Western, WB
NBP1-06274
Species: Ce, Ch, Dr, Hu, Mu, Rt, Sh, Ze
Applications: Flow, ICC/IF, IHC-FrFl, IHC, IHC-P, Simple Western, WB
NB100-309
Species: Hu, Pm, Mu, Rt
Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, KD, PAGE, Single-Cell Western, WB
NBP2-41308
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NB110-60928
Species: Al, Bv, Ca, Hu, Mu, Pm, Rt
Applications: EM, IHC, IHC-P, WB
NB100-2220
Species: Al, Av, Ba, Bv, Ca, Ch, ChHa, SyHa, Gp, Ha, Hu, In, Pm, Mu, Po, Pm, Rb, Rt, Ze
Applications: ChIP, ELISA, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, PLA, PAGE, Simple Western, WB
NBP2-01083
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
MAB6608
Species: Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow, Simple Western, WB

Publications for ATG4A Recombinant Protein (H00115201-P01) (0)

There are no publications for ATG4A Recombinant Protein (H00115201-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ATG4A Recombinant Protein (H00115201-P01) (0)

There are no reviews for ATG4A Recombinant Protein (H00115201-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ATG4A Recombinant Protein (H00115201-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ATG4A Products

Array H00115201-P01

Research Areas for ATG4A Recombinant Protein (H00115201-P01)

Find related products by research area.

Blogs on ATG4A.

ATG4A - protease that initiates ATG8 lipidation during autophagosome elongation
There are 3 major autophagy pathways- microautophagy, chaperone-mediated autophagy, and macroautophagy. Macroautophagy is the pathway herein referred to as simply autophagy. Autophagy can be broken down into 4 main stages: phagophore nucleatio...  Read full blog post.

Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ATG4A GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ATG4A