![Immunohistochemistry-Paraffin: Asialoglycoprotein Receptor 2 Antibody [NBP1-85579] - Staining in human liver and pancreas tissues using anti-ASGR2 antibody. Corresponding ASGR2 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/Asialoglycoprotein-Receptor-2-Antibody-Immunohistochemistry-Paraffin-NBP1-85579-img0008.jpg "Immunohistochemistry-Paraffin: Asialoglycoprotein Receptor 2 Antibody [NBP1-85579] - Staining in human liver and pancreas tissues using anti-ASGR2 antibody. Corresponding ASGR2 RNA-seq data are presented for the same tissues.")
| Reactivity | HuSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: YRHNYKNWAVTQPDNWHGHELGGSEDCVEVQPDGRWNDDFCLQVYRWVCEKR |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ASGR2 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for Asialoglycoprotein Receptor 2 Antibody (NBP1-85579)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: Asialoglycoprotein Receptor 2 Antibody [NBP1-85579] - Staining of human colon, liver, lymph node and pancreas using Anti-ASGR2 antibody NBP1-85579 (A) shows similar protein distribution across tissues to independent antibody NBP1-85578 (B).](http://images.novusbio.com/fullsize/Asialoglycoprotein-Receptor-2-Antibody-Immunohistochemistry-Paraffin-NBP1-85579-img0009.jpg "Immunohistochemistry-Paraffin: Asialoglycoprotein Receptor 2 Antibody [NBP1-85579] - Staining of human colon, liver, lymph node and pancreas using Anti-ASGR2 antibody NBP1-85579 (A) shows similar protein distribution across tissues to independent antibody NBP1-85578 (B).")
![Immunohistochemistry-Paraffin: Asialoglycoprotein Receptor 2 Antibody [NBP1-85579] - Staining of human pancreas using Anti-ASGR2 antibody NBP1-85579.](http://images.novusbio.com/fullsize/Asialoglycoprotein-Receptor-2-Antibody-Immunohistochemistry-Paraffin-NBP1-85579-img0013.jpg "Immunohistochemistry-Paraffin: Asialoglycoprotein Receptor 2 Antibody [NBP1-85579] - Staining of human pancreas using Anti-ASGR2 antibody NBP1-85579.")
![Immunohistochemistry-Paraffin: Asialoglycoprotein Receptor 2 Antibody [NBP1-85579] - Staining of human liver shows high expression.](http://images.novusbio.com/fullsize/Asialoglycoprotein-Receptor-2-Antibody-Immunohistochemistry-Paraffin-NBP1-85579-img0006.jpg "Immunohistochemistry-Paraffin: Asialoglycoprotein Receptor 2 Antibody [NBP1-85579] - Staining of human liver shows high expression.")
![Immunohistochemistry-Paraffin: Asialoglycoprotein Receptor 2 Antibody [NBP1-85579] - Staining of human pancreas shows low expression as expected.](http://images.novusbio.com/fullsize/Asialoglycoprotein-Receptor-2-Antibody-Immunohistochemistry-Paraffin-NBP1-85579-img0007.jpg "Immunohistochemistry-Paraffin: Asialoglycoprotein Receptor 2 Antibody [NBP1-85579] - Staining of human pancreas shows low expression as expected.")
![Immunohistochemistry-Paraffin: Asialoglycoprotein Receptor 2 Antibody [NBP1-85579] - Staining of human lymph node.](http://images.novusbio.com/fullsize/Asialoglycoprotein-Receptor-2-Antibody-Immunohistochemistry-Paraffin-NBP1-85579-img0010.jpg "Immunohistochemistry-Paraffin: Asialoglycoprotein Receptor 2 Antibody [NBP1-85579] - Staining of human lymph node.")
![Immunohistochemistry-Paraffin: Asialoglycoprotein Receptor 2 Antibody [NBP1-85579] - Staining of human colon.](http://images.novusbio.com/fullsize/Asialoglycoprotein-Receptor-2-Antibody-Immunohistochemistry-Paraffin-NBP1-85579-img0011.jpg "Immunohistochemistry-Paraffin: Asialoglycoprotein Receptor 2 Antibody [NBP1-85579] - Staining of human colon.")
![Immunohistochemistry-Paraffin: Asialoglycoprotein Receptor 2 Antibody [NBP1-85579] - Staining of human liver using Anti-ASGR2 antibody NBP1-85579.](http://images.novusbio.com/fullsize/Asialoglycoprotein-Receptor-2-Antibody-Immunohistochemistry-Paraffin-NBP1-85579-img0012.jpg "Immunohistochemistry-Paraffin: Asialoglycoprotein Receptor 2 Antibody [NBP1-85579] - Staining of human liver using Anti-ASGR2 antibody NBP1-85579.")
![Immunocytochemistry Intelectin-1/Omentin Antibody [Unconjugated]](https://images.novusbio.com/images2/Intelectin1_AF4254_Immunocytochemistry__Immunofluorescence_21420.jpg)
![Immunohistochemistry Intelectin-1/Omentin Antibody [Unconjugated]](https://images.novusbio.com/images2/Intelectin-1_AF4254_Immunohistochemistry_6829.jpg)
![Immunocytochemistry Intelectin-1/Omentin Antibody [Unconjugated]](https://images.novusbio.com/images2/af4254_human-intelectin-1-omentin-affinity-purified-polyclonal-ab-immunocytochemistry-96202275339.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")