Home » ASCIZ » ASCIZ Proteins » ASCIZ Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

ASCIZ Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for ASCIZ Recombinant Protein Antigen (NBP2-58746PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

ASCIZ Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ASCIZ.

Source: E. coli

Amino Acid Sequence: SVSELSRAVRTNILCTVRGCGKILPNSPALNMHLVKSHRLQDGIVNPTIRKDLKTGPKFYCCPIEGCPRGPERPFSQFSLVKQHFMKMHAEKKHKC

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ATMIN
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-58746.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking tide related information and a protocol, click here.
Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ASCIZ Recombinant Protein Antigen

  • ASCIZ
  • ATM INteracting protein
  • ATM interactor
  • ATM/ATR-substrate CHK2-interacting zinc finger protein
  • ATM/ATR-Substrate Chk2-Interacting Zn++-finger protein
  • DKFZp779K1455
  • FLJ50270
  • FLJ61620
  • FLJ76795
  • KIAA0431
  • zinc finger protein 822
  • ZNF822

Background

ASCIZ plays a crucial role in cell survival and RAD51 foci formation in response to methylating DNA damage. Involved in regulating the activity of ATM in the absence of DNA damage. May play a role in stabilizing ATM

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

ATM Antibody (2C1)
NB100-309
Knockdown Validated ATM Antibody (2C1)
Knockdown Validated ATM Antibody (2C1)
Immunoprecipitation ATM Antibody (2C1)
(3 Reviews)
(131 Publications)
Species: Hu, Pm, Mu, Rt
Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, KD, PAGE, Single-Cell Western, WB
PIN/DLC8 Antibody
[Unconjugated]
AF877
PIN/DLC8 Antibody [Unconjugated]
(4 Publications)
Species: Hu
Applications: IHC, IP, WB
Nbs1 Antibody
NB100-143
Knockout Validated Nbs1 Antibody
Western Blot Nbs1 Antibody
Knockdown Validated Nbs1 Antibody
(8 Reviews)
(203 Publications)
Species: Ha, Hu, Ma, Mu, Pm
Applications: ChIP, ChIP, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP, ISH, KD, KO, PAGE, WB
Chk2 [p Thr68]
Antibody [Unconjugate
AF1626
Western Blot Chk2 [p Thr68] Antibody [Unconjugated]
Immunocytochemistry Chk2 [p Thr68] Antibody [Unconjugated]
(9 Publications)
Species: Hu
Applications: ICC, WB
NLRP2/NALP2
Antibody
NB100-56155
Immunohistochemistry-Paraffin NLRP2/NALP2 Antibody
Western Blot NLRP2/NALP2 Antibody
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, IP, WB
FGF-10
[Unconjugated]
345-FG
SDS-PAGE FGF-10 [Unconjugated]
Bioactivity FGF-10 [Unconjugated]
Bioactivity FGF-10 [Unconjugated]
(103 Publications)
Species: Hu
Applications: BA
Bim Antibody - BSA
Free
NBP1-76963
Immunocytochemistry/ Immunofluorescence Bim Antibody - BSA Free
Western Blot Bim Antibody - BSA Free
Western Blot Bim Antibody - BSA Free
(8 Publications)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, Simple Western, WB
p53 Antibody (PAb
240) - BSA Free
NB200-103
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow (Intracellular) p53 Antibody (PAb 240) - BSA Free
(3 Reviews)
(42 Publications)
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Artemin Antibody
[Unconjugated]
AF1085
Neutralization Artemin Antibody [Unconjugated]
(7 Publications)
Species: Mu
Applications: IHC, Neut, WB
BCR Antibody
AF5129
Western Blot BCR Antibody
(1 Publication)
Species: Hu
Applications: WB
SLC7A5/LAT1
Antibody (BU53) - BSA
NBP2-50465
Immunohistochemistry-Paraffin SLC7A5/LAT1 Antibody (BU53) - BSA Free
Flow (Cell Surface) SLC7A5/LAT1 Antibody (BU53) - BSA Free
Flow (Cell Surface) SLC7A5/LAT1 Antibody (BU53) - BSA Free
(3 Publications)
Species: Hu
Applications: CyTOF-ready, Flow-CS, Flow, IHC, IHC-P
Dynein light chain
2 cytoplasmic Antibod ...
NBP2-92136
Western Blot Dynein light chain 2 cytoplasmic Antibody - Azide and BSA Free
Immunocytochemistry/ Immunofluorescence Dynein light chain 2 cytoplasmic Antibody - Azide and BSA Free
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
DNA Polymerase
beta Antibody
NBP2-38600
Immunocytochemistry/ Immunofluorescence DNA Polymerase beta Antibody
Immunohistochemistry-Paraffin DNA Polymerase beta Antibody
Immunohistochemistry-Paraffin DNA Polymerase beta Antibody
(1 Review)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
CIB1 Antibody
(791119) [Unconjugate
MAB7557
Western Blot CIB1 Antibody (791119) [Unconjugated]
Immunohistochemistry CIB1 Antibody (791119) [Unconjugated]
(1 Publication)
Species: Hu
Applications: IHC, WB
Chk1 Antibody
NB100-464
Immunoprecipitation Chk1 Antibody
Immunohistochemistry-Paraffin Chk1 Antibody
Western Blot Chk1 Antibody
(12 Publications)
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
RDH11 Antibody
(OTI1B4)
NBP2-02431
Flow Cytometry RDH11 Antibody (OTI1B4)
Western Blot RDH11 Antibody (OTI1B4)
Immunocytochemistry/ Immunofluorescence RDH11 Antibody (OTI1B4)
(2 Publications)
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
SMC1 Antibody
NB100-204
Immunohistochemistry-Paraffin SMC1 Antibody
Immunohistochemistry-Paraffin SMC1 Antibody
Unknown SMC1 Antibody
(36 Publications)
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
TEM8/ANTXR1
Antibody (200C1339(SB ...
NB100-56585
Immunohistochemistry-Paraffin TEM8/ANTXR1 Antibody (200C1339(SB20)) - BSA Free
Immunohistochemistry-Paraffin TEM8/ANTXR1 Antibody (200C1339(SB20)) - BSA Free
Western Blot TEM8/ANTXR1 Antibody (200C1339(SB20)) - BSA Free
(5 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NEK1 Antibody
NBP1-82884
Immunohistochemistry-Paraffin NEK1 Antibody
Immunohistochemistry-Paraffin NEK1 Antibody
Immunohistochemistry-Paraffin NEK1 Antibody
(1 Review)
Species: Hu, Mu
Applications: IHC, IHC-P
ATR Antibody (2B5)
NB100-308
Immunocytochemistry/ Immunofluorescence ATR Antibody (2B5)
Western Blot ATR Antibody (2B5)
Western Blot ATR Antibody (2B5)
(21 Publications)
Species: Hu, Mu
Applications: Func, ICC/IF, IP, In vitro, KO, WB

Publications for ASCIZ Recombinant Protein Antigen (NBP2-58746PEP) (0)

There are no publications for ASCIZ Recombinant Protein Antigen (NBP2-58746PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ASCIZ Recombinant Protein Antigen (NBP2-58746PEP) (0)

There are no reviews for ASCIZ Recombinant Protein Antigen (NBP2-58746PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ASCIZ Recombinant Protein Antigen (NBP2-58746PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ASCIZ Products

Array NBP2-58746PEP

Blogs on ASCIZ

There are no specific blogs for ASCIZ, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Knockout Validated: Nbs1 Antibody [NB100-143] - Lysates of HeLa human cervical epithelial carcinoma parental cell line and Nbs1 knockout (KO) HeLa cell line. PVDF membrane was probed with 1:1000 of Rabbit Anti-Human Polyclonal [NB100-143] followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (HAF008). Specific band was detected for Nbs1 at approximately 95 kDa (as indicated) in the parental HeLa cell line, but is not detectable in the knockout HeLa cell line. This experiment was conducted under reducing conditions.
Nbs1 Antibody
NB100-143
Knockdown Validated: ATM Antibody (2C1) [NB100-309] - Non-transfected (-) and transfected (+) HeLa whole cell extracts (60 ug) were separated by 5% SDS-PAGE, and the membrane was blotted with ATM antibody (2C1) [NB100-309] diluted at 1:500.
ATM Antibody (2C1)
NB100-309

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ASCIZ Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol ATMIN