Reactivity | HuSpecies Glossary |
Applications | WB, ICC/IF, IHC |
Clonality | Polyclonal |
Host | Rabbit |
Conjugate | Unconjugated |
Immunogen | This ASC/TMS1 Antibody was developed against a recombinant protein corresponding to amino acids: ALIARVTNVEWLLDALYGKVLTDEQYQAVRAEPTNPSKMRKLFSFTPAWNWTCKDLLLQALRESQSYLVEDLERS |
Isotype | IgG |
Clonality | Polyclonal |
Host | Rabbit |
Gene | PYCARD |
Purity | Immunogen affinity purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
||
Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100. |
||
Control Peptide |
|
Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer | PBS (pH 7.2) and 40% Glycerol |
Preservative | 0.02% Sodium Azide |
Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for ASC/TMS1 Antibody (NBP2-48925)Find related products by research area.
|
The NLRP3 Inflammasome: Macrophage Activator & Pathology Driver By Victoria Osinski, PhDWhat is the NLRP3 Inflammasome?With its critical role in innate immunity, the nucleotide-binding oligomerization domain-like receptor family, pyrin domain containing 3 (NLRP3) inflammasome ... Read full blog post. |
Pyroptosis: Mechanisms mediating cell death and pro-inflammatory cytokine release By Victoria OsinskiPyroptosis is an inflammatory form of programmed cell death characterized by the release of pro-inflammatory cytokines IL-1 beta and IL-18.1,10 It is a process distinct from apoptosis and necrosis (T... Read full blog post. |
The inflammasome: an inflammation-initiating machine, Novus Biologicals By Stephanie Melchor The inflammasome is a large, multimeric protein complex found primarily in innate immune cells, which are white blood cells that can attack a wide range of pathogenic threats. Three main elements ... Read full blog post. |
Immunity’s flipside: Microglia promote Alzheimer’s pathology during inflammation By Jamshed Arslan Pharm.D. Microglia are brain's macrophages. In Alzheimer's disease (AD), microglia clear up protein aggregates called amyloid beta plaques. The connection between immune activation and AD is unclea... Read full blog post. |
CARD & NFKB Antibodies for Apoptosis Research Apoptosis is one of the main types of programmed cell death which involves a cascade of biochemical events leading to specific cell morphology characteristics and ultimately death of cells.Caspases play crucial roles in modulating cellular signaling... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
Gene Symbol | PYCARD |