![Immunohistochemistry-Paraffin: ARPP-21 Antibody [NBP1-90096] - Staining of human skeletal muscle shows very weak cytoplasmic positivity in myocytes.](http://images.novusbio.com/fullsize/ARPP-21-Antibody-Immunohistochemistry-Paraffin-NBP1-90096-img0016.jpg "Immunohistochemistry-Paraffin: ARPP-21 Antibody [NBP1-90096] - Staining of human skeletal muscle shows very weak cytoplasmic positivity in myocytes.")
| Reactivity | HuSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: EQGDLNQAIAEEGGTEQETATPENGIVKSESLDEEEKLELQRRLEAQNQERRKSKSGAGKGKLTRSLAVCEESSARPGGESLQDQESIHLQLSSFSSLQEEDKSRKDDSEREKEKDKNKDKTSEKPKIRMLSKDCSQEYT |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ARPP21 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: ARPP-21 Antibody [NBP1-90096] - Analysis in human cerebral cortex and prostate tissues. Corresponding ARPP21 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/ARPP-21-Antibody-Immunohistochemistry-Paraffin-NBP1-90096-img0012.jpg "Immunohistochemistry-Paraffin: ARPP-21 Antibody [NBP1-90096] - Analysis in human cerebral cortex and prostate tissues. Corresponding ARPP21 RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: ARPP-21 Antibody [NBP1-90096] - Staining of human cerebral cortex shows weak cytoplasmic positivity in neurons.](http://images.novusbio.com/fullsize/ARPP-21-Antibody-Immunohistochemistry-Paraffin-NBP1-90096-img0013.jpg "Immunohistochemistry-Paraffin: ARPP-21 Antibody [NBP1-90096] - Staining of human cerebral cortex shows weak cytoplasmic positivity in neurons.")
![Immunohistochemistry-Paraffin: ARPP-21 Antibody [NBP1-90096] - Staining of human kidney shows no positivity in cells in tubules as expected.](http://images.novusbio.com/fullsize/ARPP-21-Antibody-Immunohistochemistry-Paraffin-NBP1-90096-img0014.jpg "Immunohistochemistry-Paraffin: ARPP-21 Antibody [NBP1-90096] - Staining of human kidney shows no positivity in cells in tubules as expected.")
![Immunohistochemistry-Paraffin: ARPP-21 Antibody [NBP1-90096] - Staining of human prostate shows no positivity in glandular cells as expected.](http://images.novusbio.com/fullsize/ARPP-21-Antibody-Immunohistochemistry-Paraffin-NBP1-90096-img0015.jpg "Immunohistochemistry-Paraffin: ARPP-21 Antibody [NBP1-90096] - Staining of human prostate shows no positivity in glandular cells as expected.")
![N/A BDNF [HRP]](https://images.novusbio.com/images2/DATA_BDNF_DBD00_ELISA_587.jpg)
![N/A BDNF [HRP]](https://images.novusbio.com/images2/DATA_BDNF_DBD00_ELISA_588.jpg)
![N/A BDNF [HRP]](https://images.novusbio.com/images2/BDNF_DBD00_ELISA_36.jpg)
![Flow Cytometry Mer Antibody [Unconjugated]](https://images.novusbio.com/images2/Mer_AF591_Flow_Cytometry_12100.jpg)
![Immunohistochemistry Mer Antibody [Unconjugated]](https://images.novusbio.com/images2/Mer_AF591_Immunohistochemistry_22755.jpg)
![Dual RNAscope ISH-IHC Compatible Mer Antibody [Unconjugated]](https://images.novusbio.com/images2/Mer_AF591_Dual_RNAscope_ISHIHC_23834.jpg)
![SDS-PAGE LIGHT/TNFSF14 [Unconjugated]](https://images.novusbio.com/images2/LIGHT_664-LI_719.jpg)
![Bioactivity LIGHT/TNFSF14 [Unconjugated]](https://images.novusbio.com/images2/LIGHT_664-LI_721.jpg)
![SDS-PAGE CNTF [Unconjugated]](https://images.novusbio.com/images2/CNTF_257-NT_502.jpg)
![Bioactivity CNTF [Unconjugated]](https://images.novusbio.com/images2/CNTF_257-NT_520.jpg)
![Immunohistochemistry FGF acidic/FGF1 Antibody [Unconjugated]](https://images.novusbio.com/images2/FGF_acidic_AF232_Immunohistochemistry_17183.jpg)
![Simple Western FGF acidic/FGF1 Antibody [Unconjugated]](https://images.novusbio.com/images2/FGF_acidic_AF232_Simple_Western_17471.jpg)
![Western Blot FGF acidic/FGF1 Antibody [Unconjugated]](https://images.novusbio.com/images2/FGF_acidic_AF232_Western_Blot_18640.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")