![Western Blot: ARP10 Antibody [NBP1-91682] - Endogenous APOBEC3H stability/instability occurs at the protein level. Immunoblots showing endogenous A3H, A3G, and HSP90 protein levels in stimulated primary T lymphocytes from 4 donors with the indicated A3H haplotypes (donors 10, 11, 12, and 18). In this experiment endogenous A3H is detected with a polyclonal rabbit antibody. Image collected and cropped by CiteAb from the following publication (//journals.plos.org/plosgenetics/article?id=10.1371/journal.pgen.1004761), licensed under a CC-BY license.](http://images.novusbio.com/fullsize/ARP10-Antibody-Western-Blot-NBP1-91682-img0005.jpg "Western Blot: ARP10 Antibody [NBP1-91682] - Endogenous APOBEC3H stability/instability occurs at the protein level. Immunoblots showing endogenous A3H, A3G, and HSP90 protein levels in stimulated primary T lymphocytes from 4 donors with the indicated A3H haplotypes (donors 10, 11, 12, and 18). In this experiment endogenous A3H is detected with a polyclonal rabbit antibody. Image collected and cropped by CiteAb from the following publication (//journals.plos.org/plosgenetics/article?id=10.1371/journal.pgen.1004761), licensed under a CC-BY license.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: CSSCAWELVDFIKAHDHLNLGIFASRLYYHWCKPQQKGLRLLCGSQVPVEVMGFPEFADCWENFVDHEKPLSFNPYKMLEELDKNSRAIKRRLERIKQS |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | APOBEC3H |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval method is recommended. |
||
| Theoretical MW | 24 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
||
| Control Peptide |
|
||
| Reviewed Applications |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Images | Ratings | Applications | Species | Date | Details | ||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Michael Carpenter |
WB | Human | 11/17/2017 |
Summary
|
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Western Blot: ARP10 Antibody [NBP1-91682] - A) APOBEC3H (A3H) haplotype II SV183 and various mutants expressed in 293T cells. B) The Novus anti-ARP10 antibody detected two splice variants of A3H, SV183 and SV200 in MCF-7 cell lysates. Transient transfection, overnight incubation with primary. WB image submitted by a verified customer review.](http://images.novusbio.com/fullsize/ARP10-Antibody-Western-Blot-NBP1-91682-img0004.jpg "Western Blot: ARP10 Antibody [NBP1-91682] - A) APOBEC3H (A3H) haplotype II SV183 and various mutants expressed in 293T cells. B) The Novus anti-ARP10 antibody detected two splice variants of A3H, SV183 and SV200 in MCF-7 cell lysates. Transient transfection, overnight incubation with primary. WB image submitted by a verified customer review.")
![Immunohistochemistry-Paraffin: ARP10 Antibody [NBP1-91682] - Staining of human fallopian tube shows moderate cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/antibody/nbp1-91682_rabbit-polyclonal-arp10-antibody-immunohistochemistry-paraffin-2882023101533..jpg "Immunohistochemistry-Paraffin: ARP10 Antibody [NBP1-91682] - Staining of human fallopian tube shows moderate cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: ARP10 Antibody [NBP1-91682] - Staining of human pancreas shows strong cytoplasmic granular positivity in a subset of exocrine glandular cells.](http://images.novusbio.com/fullsize/antibody/nbp1-91682_rabbit-polyclonal-arp10-antibody-immunohistochemistry-paraffin-2882023101717..jpg "Immunohistochemistry-Paraffin: ARP10 Antibody [NBP1-91682] - Staining of human pancreas shows strong cytoplasmic granular positivity in a subset of exocrine glandular cells.")
![Immunohistochemistry-Paraffin: ARP10 Antibody [NBP1-91682] - Staining of human liver shows no positivity in hepatocytes as expected.](http://images.novusbio.com/fullsize/antibody/nbp1-91682_rabbit-polyclonal-arp10-antibody-immunohistochemistry-paraffin-2882023101817..jpg "Immunohistochemistry-Paraffin: ARP10 Antibody [NBP1-91682] - Staining of human liver shows no positivity in hepatocytes as expected.")
![Immunohistochemistry-Paraffin: ARP10 Antibody [NBP1-91682] - Staining of human skin shows no positivity in squamous epithelial cells as expected.](http://images.novusbio.com/fullsize/antibody/nbp1-91682_rabbit-polyclonal-arp10-antibody-immunohistochemistry-paraffin-2882023101921..jpg "Immunohistochemistry-Paraffin: ARP10 Antibody [NBP1-91682] - Staining of human skin shows no positivity in squamous epithelial cells as expected.")
![Western Blot: ARP10 Antibody [NBP1-91682] - Generation & validation of HIV-1 Vif separation-of-function molecular/viral probes.A) A schematic of the Vif protein encoded by each HIV-1 molecular clone showing amino acid differences responsible for the hyper- & hypo-Vif functionality relative to lab-Vif (HIV-1 IIIB/NL4-3) against stable A3H haplotype II. B) Immunoblots showing the expression levels of the indicated A3 proteins stably expressed in SupT11 cells. In this experiment untagged A3H is detected with the mouse monoclonal antibody P3A3-A10. C) HIV-1 spreading infection kinetics for the indicated viruses on A3-expressing SupT11 cells lines described in panel B. The hyper-, lab-, & hypo-Vif isolates spread with similar kinetics on cells expressing a control vector, A3D, A3F, or A3G, but showed clear phenotypic differences on cells expressing low, intermediate (int), & high levels of stable A3H haplotype II. Delta-Vif virus replication was evident in control vector expressing SupT11 cells, delayed in A3D expressing cells, & suppressed under all other conditions (some symbols eclipsed). Image collected & cropped by CiteAb from the following publication (//dx.plos.org/10.1371/journal.pgen.1004761), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp1-91682_rabbit-polyclonal-arp10-antibody-310202416114736.jpg "Western Blot: ARP10 Antibody [NBP1-91682] - Generation & validation of HIV-1 Vif separation-of-function molecular/viral probes.A) A schematic of the Vif protein encoded by each HIV-1 molecular clone showing amino acid differences responsible for the hyper- & hypo-Vif functionality relative to lab-Vif (HIV-1 IIIB/NL4-3) against stable A3H haplotype II. B) Immunoblots showing the expression levels of the indicated A3 proteins stably expressed in SupT11 cells. In this experiment untagged A3H is detected with the mouse monoclonal antibody P3A3-A10. C) HIV-1 spreading infection kinetics for the indicated viruses on A3-expressing SupT11 cells lines described in panel B. The hyper-, lab-, & hypo-Vif isolates spread with similar kinetics on cells expressing a control vector, A3D, A3F, or A3G, but showed clear phenotypic differences on cells expressing low, intermediate (int), & high levels of stable A3H haplotype II. Delta-Vif virus replication was evident in control vector expressing SupT11 cells, delayed in A3D expressing cells, & suppressed under all other conditions (some symbols eclipsed). Image collected & cropped by CiteAb from the following publication (//dx.plos.org/10.1371/journal.pgen.1004761), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Immunohistochemistry Angiopoietin-like Protein 1/ANGPTL1 Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af2204_human-angiopoietin-like-1-affinity-purified-polyclonal-ab-immunohistochemistry-27122022161939.jpg)
![Immunohistochemistry PITX2 Antibody [Unconjugated]](https://images.novusbio.com/images2/PITX2_AF7388_Immunohistochemistry_12162.jpg)
![Knockdown Validated COUP-TF II/NR2F2 Antibody (H7147) [Unconjugated]](https://images.novusbio.com/images/pp-h7147-00_human-coup-tf-ii-nr2f2-mab-clone-h7147-41202412505335.jpg)
![Knockdown Validated COUP-TF II/NR2F2 Antibody (H7147) [Unconjugated]](https://images.novusbio.com/images/pp-h7147-00_human-coup-tf-ii-nr2f2-mab-clone-h7147-41202412505337.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")
