Home » Amphiphysin/AMPH » Amphiphysin/AMPH Proteins » Amphiphysin/AMPH Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

Amphiphysin/AMPH Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for Amphiphysin/AMPH Protein (NBP1-86033PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Amphiphysin/AMPH Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human AMPH.

Source: E. coli

Amino Acid Sequence: PGFLYKVETLHDFEAANSDELTLQRGDVVLVVPSDSEADQDAGWLVGVKESDWLQYRDLATYKGLFPENFTRRL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
AMPH
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-86033.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.
Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Amphiphysin/AMPH Recombinant Protein Antigen

  • AMPH
  • AMPH1
  • amphiphysin (Stiff-Man syndrome with breast cancer 128kDa autoantigen)
  • amphiphysin (Stiff-Mann syndrome with breast cancer 128kD autoantigen)
  • amphiphysin I
  • Amphiphysin

Background

Amphiphysin, a neuronal protein first identified in chicken synaptic membranes, is the autoantigen of Stiff-Man Syndrome (SMS) associated with breast cancer. Patient autoantibodies have a distinct pattern of reactivity with amphiphysin, and the dominant autoepitope is located in its C-terminal region, which contains an SH3 domain (1). Amphiphysin is expressed in many neurons, certain endocrine cell types, and spermatocytes (2). study suggests a link between amphiphysin I expression in cancer and amphiphysin I autoimmunity. The enhanced expression of amphiphysin I in some forms of cancer supports the hypothesis that amphiphysin family members may play a role in the biology of cancer cells (3).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

SLC6A3/DAT1
Antibody (mAb16)
NBP2-22164
Western Blot SLC6A3/DAT1 Antibody (mAb16)
Western Blot SLC6A3/DAT1 Antibody (mAb16)
Immunohistochemistry-Paraffin SLC6A3/DAT1 Antibody (mAb16)
(3 Reviews)
(14 Publications)
Species: Hu(-), Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
beta-2 Adrenergic
R/ADRB2 Antibody (JM1 ...
NBP2-67187
Immunohistochemistry-Paraffin beta-2 Adrenergic R/ADRB2 Antibody (JM102-06)
Immunohistochemistry-Paraffin beta-2 Adrenergic R/ADRB2 Antibody (JM102-06)
Western Blot beta-2 Adrenergic R/ADRB2 Antibody (JM102-06)
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-P, IP, WB
FXR/NR1H4 Antibody
(A9033A) [Unconjugate ...
PP-A9033A-00
FXR/NR1H4 Antibody (A9033A) [Unconjugated]
(2 Reviews)
(14 Publications)
Species: Hu
Applications: DirELISA, IHC, IP, WB
BFAR Antibody
NB100-56094
Western Blot BFAR Antibody
Immunohistochemistry-Paraffin BFAR Antibody
Immunohistochemistry-Paraffin BFAR Antibody
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, IP, WB
DIO2 Antibody
NBP1-00178
Flow Cytometry DIO2 Antibody
Immunocytochemistry/ Immunofluorescence DIO2 Antibody
Immunohistochemistry-Frozen DIO2 Antibody
(8 Publications)
Species: Hu, Mu, Sh
Applications: Flow, ICC/IF, IHC, IHC-Fr, PEP-ELISA, WB
Neuropeptide Y
Antibody
NBP1-46535
Immunohistochemistry Neuropeptide Y Antibody
Immunocytochemistry/ Immunofluorescence Neuropeptide Y Antibody
(20 Publications)
Species: Hu, Mu, Rb, Rt, Xp
Applications: ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, WB
BIN1 Antibody
NBP1-89102
Immunohistochemistry-Paraffin BIN1 Antibody
Immunohistochemistry-Paraffin BIN1 Antibody
Western Blot BIN1 Antibody
(2 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
BBS9 Antibody
NBP1-88927
Immunohistochemistry-Paraffin BBS9 Antibody
(3 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
LMOD1 Antibody
NBP1-89396
Immunocytochemistry/ Immunofluorescence LMOD1 Antibody
Immunohistochemistry-Paraffin LMOD1 Antibody
Immunohistochemistry-Paraffin LMOD1 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
c-Fos Antibody
(2H2)
NBP2-50037
Knockout Validated c-Fos Antibody (2H2)
Immunocytochemistry/ Immunofluorescence c-Fos Antibody (2H2)
Immunocytochemistry/ Immunofluorescence c-Fos Antibody (2H2)
(1 Review)
(20 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
Histidase Antibody
(4F2)
H00003034-M04
Western Blot Histidase Antibody (4F2)
Immunoprecipitation Histidase Antibody (4F2)
(3 Publications)
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
Src [p Tyr419]
Antibody [Unconjugate
AF2685
Western Blot Src [p Tyr419] Antibody [Unconjugated]
Simple Western Src [p Tyr419] Antibody [Unconjugated]
Immunohistochemistry Src [p Tyr419] Antibody [Unconjugated]
(1 Review)
(10 Publications)
Species: Hu
Applications: IHC, Simple Western, WB
Tyrosine
Hydroxylase Antibody
NB300-109
Immunohistochemistry-Frozen Tyrosine Hydroxylase Antibody
Immunohistochemistry Tyrosine Hydroxylase Antibody
Immunohistochemistry Tyrosine Hydroxylase Antibody
(7 Reviews)
(230 Publications)
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
Holo-Transferrin
[Unconjugated]
2914-HT
Holo-Transferrin [Unconjugated]
(50 Publications)
Species: Hu
Applications: BA
POMC Antibody
NB100-1533
Flow Cytometry POMC Antibody
Immunohistochemistry POMC Antibody
Immunohistochemistry POMC Antibody
(10 Publications)
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
CRMP5 Antibody
NBP1-33419
Western Blot CRMP5 Antibody
Immunohistochemistry-Paraffin CRMP5 Antibody
Western Blot CRMP5 Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
GAD1/GAD67
Antibody [Unconjugate
AF2086
Immunohistochemistry GAD1/GAD67 Antibody [Unconjugated]
Western Blot GAD1/GAD67 Antibody [Unconjugated]
Simple Western GAD1/GAD67 Antibody [Unconjugated]
(13 Publications)
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
ERMAP Antibody
[Unconjugated]
AF4928
Flow Cytometry ERMAP Antibody [Unconjugated]
Species: Hu
Applications: CyTOF-ready, Flow, WB

Publications for Amphiphysin/AMPH Protein (NBP1-86033PEP) (0)

There are no publications for Amphiphysin/AMPH Protein (NBP1-86033PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Amphiphysin/AMPH Protein (NBP1-86033PEP) (0)

There are no reviews for Amphiphysin/AMPH Protein (NBP1-86033PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Amphiphysin/AMPH Protein (NBP1-86033PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Amphiphysin/AMPH Products

Research Areas for Amphiphysin/AMPH Protein (NBP1-86033PEP)

Find related products by research area.

Blogs on Amphiphysin/AMPH

There are no specific blogs for Amphiphysin/AMPH, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

10x Magnification cryo-sections mouse: primary antibody: anti-rb TH: 1:500; o.n. secondary antibody: 1:500 dk-anti-rb DyLight488. IHC-Fr image submitted by a verified customer review.
Tyrosine Hydroxylase Antibody
NB300-109

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Amphiphysin/AMPH Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol AMPH