Home » Alkaline Phosphatase, Intestinal » Alkaline Phosphatase, Intestinal Proteins » Recombinant Human Alkaline Phosphatase, Intestinal GST (N-Term) Protein
Novus Biologicals products are now on bio-techne.com

Recombinant Human Alkaline Phosphatase, Intestinal GST (N-Term) Protein

 Submit a Review

Images

 
(
Enlarge)
SDS-Page: Recombinant Human Alkaline Phosphatase, Intestinal Protein [H00000248-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.
SDS-Page: Recombinant Human Alkaline Phosphatase, Intestinal Protein [H00000248-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, AP

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Recombinant Human Alkaline Phosphatase, Intestinal GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 74-162 of Human Alkaline Phosphatase, Intestinal

Source: Wheat Germ (in vitro)

Amino Acid Sequence: LKGQKNGKLGPETPLAMDRFPYLALSKTYNVDRQVPDSAATATAYLCGVKANFQTIGLSAAARFNQCNTTRGNEVISVMNRAKQAGKSV
Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
ALPI
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
35.53 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Alkaline Phosphatase, Intestinal GST (N-Term) Protein

  • alkaline phosphatase, intestinal
  • Alkaline phosphomonoesterase
  • ALPI
  • EC 3.1.3.1
  • Glycerophosphatase
  • IAP
  • Intestinal alkaline phosphatase
  • intestinal-type alkaline phosphatase
  • Kasahara isozyme

Background

ALPI - alkaline phosphatase, intestinal

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

XIAP Antibody
[Unconjugated]
AF8221
Western Blot XIAP Antibody [Unconjugated]
Simple Western XIAP Antibody [Unconjugated]
Knockout Validated XIAP Antibody [Unconjugated]
(23 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
Survivin Antibody
- BSA Free
NB500-201
Flow Cytometry Survivin Antibody - BSA Free
Dual RNAscope ISH-IHC Survivin Antibody - BSA Free
Knockdown Validated Survivin Antibody - BSA Free
(22 Reviews)
(373 Publications)
Species: Ca, Fe, Gp, Ha, Hu, Mu, Rt
Applications: ChIP, Dual ISH-IHC, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, Simple Western, WB
SMAC/Diablo
Antibody
NB100-56311
Western Blot SMAC/Diablo Antibody
Immunohistochemistry SMAC/Diablo Antibody
(16 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Survivin Antibody
- BSA Free
NB500-201
Flow Cytometry Survivin Antibody - BSA Free
Dual RNAscope ISH-IHC Survivin Antibody - BSA Free
Knockdown Validated Survivin Antibody - BSA Free
(22 Reviews)
(373 Publications)
Species: Ca, Fe, Gp, Ha, Hu, Mu, Rt
Applications: ChIP, Dual ISH-IHC, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, Simple Western, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(808 Publications)
Species: Hu
Applications: BA
CD47 Antibody
[Unconjugated]
AF4670
Western Blot CD47 Antibody [Unconjugated]
Neutralization CD47 Antibody [Unconjugated]
Immunohistochemistry CD47 Antibody [Unconjugated]
(4 Reviews)
(14 Publications)
Species: Hu
Applications: CyTOF-ready, Flow, IHC, KO, Neut, WB
Caspase-3 Antibody
[Unconjugated] - Acti ...
AF835
Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active
Immunohistochemistry Caspase-3 Antibody [Unconjugated] - Active
Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active
(7 Reviews)
(384 Publications)
Species: Hu, Mu
Applications: ICC, IHC
cIAP-1/HIAP-2
Antibody [Unconjugate
AF8181
Western Blot cIAP-1/HIAP-2 Antibody [Unconjugated]
Immunohistochemistry cIAP-1/HIAP-2 Antibody [Unconjugated]
Knockout Validated cIAP-1/HIAP-2 Antibody [Unconjugated]
(4 Reviews)
(66 Publications)
Species: Hu
Applications: IHC, KO, Simple Western, WB
cIAP-2/HIAP-1
Antibody [Unconjugate
AF8171
Western Blot cIAP-2/HIAP-1 Antibody [Unconjugated]
Simple Western cIAP-2/HIAP-1 Antibody [Unconjugated]
Immunohistochemistry cIAP-2/HIAP-1 Antibody [Unconjugated]
(17 Publications)
Species: Hu
Applications: IHC, Simple Western, WB
Bcl-2 Antibody
NB100-56098
Western Blot Bcl-2 Antibody
Western Blot Bcl-2 Antibody
Western Blot Bcl-2 Antibody
(2 Reviews)
(26 Publications)
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Livin Antibody
(88C570) - BSA Free
NB100-56548
Western Blot Livin Antibody (88C570) - BSA Free
(22 Publications)
Species: Hu
Applications: ICC/IF, WB
Caspase-9 Antibody
NB100-56118
Immunohistochemistry Caspase-9 Antibody
Immunohistochemistry Caspase-9 Antibody
Immunohistochemistry Caspase-9 Antibody
(1 Review)
(28 Publications)
Species: Ca, Ma, Hu, Mu, Rt
Applications: Flow-IC, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Alkaline
Phosphatase/ALPP Anti ...
NB110-3638
Immunocytochemistry/ Immunofluorescence Alkaline Phosphatase/ALPP Antibody (8B6) - BSA Free
Immunohistochemistry-Paraffin Alkaline Phosphatase/ALPP Antibody (8B6) - BSA Free
Western Blot Alkaline Phosphatase/ALPP Antibody (8B6) - BSA Free
(1 Review)
(15 Publications)
Species: Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, RI, WB
NFkB p105/p50
Antibody (2J10D7) - B ...
NB100-56583
Flow Cytometry NFkB p105/p50 Antibody (2J10D7) - BSA Free
Flow Cytometry NFkB p105/p50 Antibody (2J10D7) - BSA Free
Flow Cytometry NFkB p105/p50 Antibody (2J10D7) - BSA Free
(1 Review)
(5 Publications)
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, WB
TRAIL/TNFSF10
[Unconjugated]
375-TL
TRAIL/TNFSF10 [Unconjugated]
(1 Review)
(54 Publications)
Species: Hu
Applications: BA
Bcl-xL Antibody
NB100-56104
Western Blot Bcl-xL Antibody
Immunohistochemistry-Paraffin Bcl-xL Antibody
Western Blot Bcl-xL Antibody
(1 Review)
(3 Publications)
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, IP, WB
NOD2 Antibody
(2D9) - BSA Free
NB100-524
Flow Cytometry NOD2 Antibody (2D9) - BSA Free
Flow Cytometry NOD2 Antibody (2D9) - BSA Free
Immunohistochemistry-Frozen NOD2 Antibody (2D9) - BSA Free
(1 Review)
(26 Publications)
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
CTLA-4
[Unconjugated]
7268-CT
Bioactivity CTLA-4 [Unconjugated]
(3 Publications)
Species: Hu
Applications: BA

Publications for Alkaline Phosphatase, Intestinal Partial Recombinant Protein (H00000248-Q01) (0)

There are no publications for Alkaline Phosphatase, Intestinal Partial Recombinant Protein (H00000248-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Alkaline Phosphatase, Intestinal Partial Recombinant Protein (H00000248-Q01) (0)

There are no reviews for Alkaline Phosphatase, Intestinal Partial Recombinant Protein (H00000248-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Alkaline Phosphatase, Intestinal Partial Recombinant Protein (H00000248-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Alkaline Phosphatase, Intestinal Products

Research Areas for Alkaline Phosphatase, Intestinal Partial Recombinant Protein (H00000248-Q01)

Find related products by research area.

Blogs on Alkaline Phosphatase, Intestinal

There are no specific blogs for Alkaline Phosphatase, Intestinal, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005
Caspase‑3 was detected in immersion fixed anti-FAS treated Jurkat human acute T cell leukemia cell line using 0.3 µg/mL Human/Mouse Active Caspase‑3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF835) for 3 hours at room temperature. Cells were stained (red) and counterstained (green). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Caspase-3 Antibody [Unconjugated] - Active
AF835

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Alkaline Phosphatase, Intestinal GST (N-Term) Protein and receive a gift card or discount.


Bioinformatics

Gene Symbol ALPI