![Western Blot: ALDH18A1 Antibody [NBP1-83324] - Analysis using Anti-ALDH18A1 antibody NBP1-83324 (A) shows similar pattern to independent antibody NBP1-83325 (B).](http://images.novusbio.com/fullsize/ALDH18A1-Antibody-Western-Blot-NBP1-83324-img0018.jpg "Western Blot: ALDH18A1 Antibody [NBP1-83324] - Analysis using Anti-ALDH18A1 antibody NBP1-83324 (A) shows similar pattern to independent antibody NBP1-83325 (B).")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: SVTFGTKSRVGMGGMEAKVKAALWALQGGTSVVIANGTHPKVSGHVITDIVEGKKVGTFFSEVKPAGPTVEQQGEMARSGGRMLATLEPEQRAEIIHHLADLLTDQRD |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ALDH18A1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for ALDH18A1 Antibody (NBP1-83324)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry/Immunofluorescence: ALDH18A1 Antibody [NBP1-83324] - Staining of human cell line A-431 shows localization to mitochondria. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/ALDH18A1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-83324-img0011.jpg "Immunocytochemistry/Immunofluorescence: ALDH18A1 Antibody [NBP1-83324] - Staining of human cell line A-431 shows localization to mitochondria. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: ALDH18A1 Antibody [NBP1-83324] - Staining of human gastrointestinal shows strong granular cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/ALDH18A1-Antibody-Immunohistochemistry-Paraffin-NBP1-83324-img0017.jpg "Immunohistochemistry-Paraffin: ALDH18A1 Antibody [NBP1-83324] - Staining of human gastrointestinal shows strong granular cytoplasmic positivity in glandular cells.")
![Western Blot: ALDH18A1 Antibody [NBP1-83324] - Analysis in human cell line HepG2.](http://images.novusbio.com/fullsize/ALDH18A1-Antibody-Western-Blot-NBP1-83324-img0008.jpg "Western Blot: ALDH18A1 Antibody [NBP1-83324] - Analysis in human cell line HepG2.")
![Western Blot: ALDH18A1 Antibody [NBP1-83324] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.](http://images.novusbio.com/fullsize/ALDH18A1-Antibody-Western-Blot-NBP1-83324-img0009.jpg "Western Blot: ALDH18A1 Antibody [NBP1-83324] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.")
![Immunohistochemistry-Paraffin: ALDH18A1 Antibody [NBP1-83324] - Staining of human placenta shows strong granular cytoplasmic positivity in trophoblastic cells.](http://images.novusbio.com/fullsize/ALDH18A1-Antibody-Immunohistochemistry-Paraffin-NBP1-83324-img0014.jpg "Immunohistochemistry-Paraffin: ALDH18A1 Antibody [NBP1-83324] - Staining of human placenta shows strong granular cytoplasmic positivity in trophoblastic cells.")
![Immunohistochemistry-Paraffin: ALDH18A1 Antibody [NBP1-83324] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.](http://images.novusbio.com/fullsize/ALDH18A1-Antibody-Immunohistochemistry-Paraffin-NBP1-83324-img0015.jpg "Immunohistochemistry-Paraffin: ALDH18A1 Antibody [NBP1-83324] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.")
![Immunohistochemistry-Paraffin: ALDH18A1 Antibody [NBP1-83324] - Staining of human liver shows no positivity in hepatocytes as expected.](http://images.novusbio.com/fullsize/ALDH18A1-Antibody-Immunohistochemistry-Paraffin-NBP1-83324-img0016.jpg "Immunohistochemistry-Paraffin: ALDH18A1 Antibody [NBP1-83324] - Staining of human liver shows no positivity in hepatocytes as expected.")
![Western Blot Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Western_Blot_5287.jpg)
![Simple Western Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Simple_Western_16990.jpg)
![Knockout Validated Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Knockout_Validated_24032.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")