![Western Blot: AKR1CL2 Antibody [NBP1-90195] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue](http://images.novusbio.com/fullsize/AKR1CL2-Antibody-Western-Blot-NBP1-90195-img0006.jpg "Western Blot: AKR1CL2 Antibody [NBP1-90195] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: MGFKPPHPEWIMSCSELSFCLSHPRVQDLPLDESNMVIPSDTDFLDTWEAMEDLVITGLVKNIG |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | AKR1E2 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Simple Western CD117/c-kit Antibody [Unconjugated]](https://images.novusbio.com/images2/CD117_AF1356_Simple_Western_17480.jpg)
![Western Blot CD117/c-kit Antibody [Unconjugated]](https://images.novusbio.com/images2/CD117_AF1356_Western_Blot_18637.jpg)
![Immunohistochemistry CD117/c-kit Antibody [Unconjugated]](https://images.novusbio.com/images2/SCF_R_AF1356_Immunohistochemistry_9746.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for AKR1CL2 Antibody (NBP1-90195)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: AKR1CL2 Antibody [NBP1-90195] - Staining in human testis and liver tissues using anti-AKR1E2 antibody. Corresponding AKR1E2 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/AKR1CL2-Antibody-Immunohistochemistry-Paraffin-NBP1-90195-img0009.jpg "Immunohistochemistry-Paraffin: AKR1CL2 Antibody [NBP1-90195] - Staining in human testis and liver tissues using anti-AKR1E2 antibody. Corresponding AKR1E2 RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: AKR1CL2 Antibody [NBP1-90195] - Staining of human small intestine shows strong cytoplasmic positivity with granular pattern in glandular cells.](http://images.novusbio.com/fullsize/AKR1CL2-Antibody-Immunohistochemistry-Paraffin-NBP1-90195-img0002.jpg "Immunohistochemistry-Paraffin: AKR1CL2 Antibody [NBP1-90195] - Staining of human small intestine shows strong cytoplasmic positivity with granular pattern in glandular cells.")
![Immunohistochemistry-Paraffin: AKR1CL2 Antibody [NBP1-90195] - Staining of human liver shows low expression as expected.](http://images.novusbio.com/fullsize/AKR1CL2-Antibody-Immunohistochemistry-Paraffin-NBP1-90195-img0007.jpg "Immunohistochemistry-Paraffin: AKR1CL2 Antibody [NBP1-90195] - Staining of human liver shows low expression as expected.")
![Immunohistochemistry-Paraffin: AKR1CL2 Antibody [NBP1-90195] - Staining of human testis shows high expression.](http://images.novusbio.com/fullsize/AKR1CL2-Antibody-Immunohistochemistry-Paraffin-NBP1-90195-img0008.jpg "Immunohistochemistry-Paraffin: AKR1CL2 Antibody [NBP1-90195] - Staining of human testis shows high expression.")
![Chromatin Immunoprecipitation (ChIP) Oct-3/4 Antibody [Unconjugated]](https://images.novusbio.com/images2/Oct-3_4_AF1759_Chromatin_Immunoprecipitation_11218.jpg)
![Immunocytochemistry Oct-3/4 Antibody [Unconjugated]](https://images.novusbio.com/images2/Oct-3_4_AF1759_Immunocytochemistry_7093.jpg)
![Simple Western Oct-3/4 Antibody [Unconjugated]](https://images.novusbio.com/images2/Oct3_4_AF1759_Simple_Western_20183.jpg)
![Western Blot Androgen R/NR3C4 [p Ser213, p Ser210] Antibody (156C135.2) - BSA Free](https://images.novusbio.com/images/Androgen-R-NR3C4-p-Ser213-p-Ser210-Antibody-156C135-2-Western-Blot-NB100-56603-img0004.jpg)
![SCF/c-kit Ligand [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "SCF/c-kit Ligand [Unconjugated]")
![Immunohistochemistry Cyclin B1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Cyclin_B1_AF6000_Immunohistochemistry_11792.jpg)
![Western Blot Cyclin B1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Cyclin_B1_AF6000_Western_Blot_9526.jpg)
![Simple Western Cyclin B1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Cyclin_B1_AF6000_Simple_Western_20094.jpg)
![Western Blot CISH/CIS-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/CIS-1_AF3194_Western_Blot_5249.jpg)
![Immunocytochemistry CISH/CIS-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/af3194_human-cis-1-affinity-purified-polyclonal-ab-immunocytochemistry-309202194844.jpg)
![Simple Western CISH/CIS-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/af3194_human-cis-1-affinity-purified-polyclonal-ab-simple-western-1342022124434.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")