![Western Blot: Adenosine A2a R Antibody [H00000135-B01P] - Analysis of ADORA2A expression in HeLa.](http://images.novusbio.com/fullsize/Adenosine-A2a-R-Antibody-Western-Blot-H00000135-B01P-img0002.jpg "Western Blot: Adenosine A2a R Antibody [H00000135-B01P] - Analysis of ADORA2A expression in HeLa.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, Flow |
| Clonality | Polyclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Description | Quality control test: Antibody reactive against mammalian transfected lysate. |
| Immunogen | ADORA2A (AAH13780.1, 1 a.a. - 412 a.a.) full-length human protein. MPIMGSSVYITVELAIAVLAILGNVLVCWAVWLNSNLQNVTNYFVVSLAAADIAVGVLAIPFAITISTGFCAACHGCLFIACFVLVLTQSSIFSLLAIAIDRYIAIRIPLRYNGLVTGTRAKGIIAICWVLSFAIGLTPMLGWNNCGQPKEGKNHSQGCGEGQVACLFEDVVPMNYMVYFNFFACVLVPLLLMLGVYLRIFLAARRQLKQMESQPLPGERARSTLQKEVHAAKSLAIIVGLFALCWLPLHIINCFTFFCPDCSHAPLWLMYLAIVLSHTNSVVNPFIYAYRIREFRQTFRKIIRSHVLRQQEPFKAAGTSARVLAAHGSDGEQVSLRLNGHPPGVWANGSAPHPERRPNGYALGLVSGGSAQESQGNTGLPDVELLSHELKGVCPEPPGLDDPLAQDGAGVS |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Mouse |
| Gene | ADORA2A |
| Purity | Protein G purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.4) |
| Preservative | No Preservative |
| Purity | Protein G purified |
![Western Blot RFC1 Antibody [Unconjugated]](https://images.novusbio.com/images2/RFC1_AF6457_Western_Blot_9874.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for Adenosine A2aR Antibody (H00000135-B01P)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | ADORA2A |
| Uniprot |
|
![Flow Cytometry: Adenosine A2a R Antibody [H00000135-B01P] - Analysis of negative control 293 cells (Black) and ADORA2A expressing 293 cells (Green) using ADORA2A purified mouse polyclonal antibody.](http://images.novusbio.com/fullsize/Adenosine-A2a-R-Antibody-Flow-Cytometry-H00000135-B01P-img0001.jpg "Flow Cytometry: Adenosine A2a R Antibody [H00000135-B01P] - Analysis of negative control 293 cells (Black) and ADORA2A expressing 293 cells (Green) using ADORA2A purified mouse polyclonal antibody.")
![Western Blot: Adenosine A2a R Antibody [H00000135-B01P] - Analysis of ADORA2A expression in transfected 293T cell line by ADORA2A polyclonal antibody. Lane 1: ADORA2A transfected lysate(45.43 KDa). Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/Adenosine-A2a-R-Antibody-Western-Blot-H00000135-B01P-img0003.jpg "Western Blot: Adenosine A2a R Antibody [H00000135-B01P] - Analysis of ADORA2A expression in transfected 293T cell line by ADORA2A polyclonal antibody. Lane 1: ADORA2A transfected lysate(45.43 KDa). Lane 2: Non-transfected lysate.")
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Western Blot Androgen R/NR3C4 [p Ser213, p Ser210] Antibody (156C135.2) - BSA Free](https://images.novusbio.com/images/Androgen-R-NR3C4-p-Ser213-p-Ser210-Antibody-156C135-2-Western-Blot-NB100-56603-img0004.jpg)
![Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]](https://images.novusbio.com/images/Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP1-97019-img0004.jpg "Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]")