![Western Blot: ADE2 Antibody [NBP1-90235] - Analysis using Anti-PAICS antibody NBP1-90235 (A) shows similar pattern to independent antibody NBP2-58966 (B).](http://images.novusbio.com/fullsize/ADE2-Antibody-Western-Blot-NBP1-90235-img0009.jpg "Western Blot: ADE2 Antibody [NBP1-90235] - Analysis using Anti-PAICS antibody NBP1-90235 (A) shows similar pattern to independent antibody NBP2-58966 (B).")
| Reactivity | Hu, Mu, Rt, ChHaSpecies Glossary |
| Applications | WB, Simple Western, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: ETAFIAPQCEMIPIEWVCRRIATGSFLKRNPGVKEGYKFYPPKVELFFKDDANNDPQWSEEQLIAAKFCFAGLLIGQTEVDIMS |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | PAICS |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue. |
||
| Theoretical MW | 47 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for ADE2 Antibody (NBP1-90235)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: ADE2 Antibody [NBP1-90235] - Analysis in human liver and skeletal muscle tissues using NBP1-90235 antibody. Corresponding PAICS RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/ADE2-Antibody-Immunohistochemistry-Paraffin-NBP1-90235-img0015.jpg "Immunohistochemistry-Paraffin: ADE2 Antibody [NBP1-90235] - Analysis in human liver and skeletal muscle tissues using NBP1-90235 antibody. Corresponding PAICS RNA-seq data are presented for the same tissues.")
![Western Blot: ADE2 Antibody [NBP1-90235] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.](http://images.novusbio.com/fullsize/ADE2-Antibody-Western-Blot-NBP1-90235-img0008.jpg "Western Blot: ADE2 Antibody [NBP1-90235] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.")
![Immunohistochemistry-Paraffin: ADE2 Antibody [NBP1-90235] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/ADE2-Antibody-Immunohistochemistry-Paraffin-NBP1-90235-img0010.jpg "Immunohistochemistry-Paraffin: ADE2 Antibody [NBP1-90235] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: ADE2 Antibody [NBP1-90235] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.](http://images.novusbio.com/fullsize/ADE2-Antibody-Immunohistochemistry-Paraffin-NBP1-90235-img0011.jpg "Immunohistochemistry-Paraffin: ADE2 Antibody [NBP1-90235] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.")
![Immunohistochemistry-Paraffin: ADE2 Antibody [NBP1-90235] - Staining of human skeletal muscle shows very weak positivity in myocytes as expected.](http://images.novusbio.com/fullsize/ADE2-Antibody-Immunohistochemistry-Paraffin-NBP1-90235-img0012.jpg "Immunohistochemistry-Paraffin: ADE2 Antibody [NBP1-90235] - Staining of human skeletal muscle shows very weak positivity in myocytes as expected.")
![Immunohistochemistry-Paraffin: ADE2 Antibody [NBP1-90235] - Staining of human tonsil shows strong cytoplasmic positivity in germinal center cells.](http://images.novusbio.com/fullsize/ADE2-Antibody-Immunohistochemistry-Paraffin-NBP1-90235-img0013.jpg "Immunohistochemistry-Paraffin: ADE2 Antibody [NBP1-90235] - Staining of human tonsil shows strong cytoplasmic positivity in germinal center cells.")
![Simple Western: ADE2 Antibody [NBP1-90235] - Simple Western lane view shows a specific band for ADE2 in 0.2 mg/ml of RT-4 and U-251MG lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.](http://images.novusbio.com/fullsize/ADE2-Antibody-Simple-Western-NBP1-90235-img0005.jpg "Simple Western: ADE2 Antibody [NBP1-90235] - Simple Western lane view shows a specific band for ADE2 in 0.2 mg/ml of RT-4 and U-251MG lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.")
![Simple Western: ADE2 Antibody [NBP1-90235] - Electropherogram image(s) of corresponding Simple Western lane view. ADE2 antibody was used at 1:20 dilution on RT-4 and U-251MG lysate(s).](http://images.novusbio.com/fullsize/ADE2-Antibody-Simple-Western-NBP1-90235-img0006.jpg "Simple Western: ADE2 Antibody [NBP1-90235] - Electropherogram image(s) of corresponding Simple Western lane view. ADE2 antibody was used at 1:20 dilution on RT-4 and U-251MG lysate(s).")
![Western Blot Androgen R/NR3C4 [p Ser213, p Ser210] Antibody (156C135.2) - BSA Free](https://images.novusbio.com/images/Androgen-R-NR3C4-p-Ser213-p-Ser210-Antibody-156C135-2-Western-Blot-NB100-56603-img0004.jpg)
![Immunohistochemistry Trypsin 1/PRSS1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Trypsin_1_AF3848_Immunohistochemistry_17574.jpg)
![Immunohistochemistry p63/TP73L Antibody [Unconjugated]](https://images.novusbio.com/images2/p63_AF1916_Immunohistochemistry_16919.jpg)
![Immunocytochemistry p63/TP73L Antibody [Unconjugated]](https://images.novusbio.com/images2/p63_AF1916_Immunocytochemistry__Immunofluorescence_16973.jpg)
![Immunocytochemistry/ Immunofluorescence p63/TP73L Antibody [Unconjugated]](https://images.novusbio.com/images/af1916_human-p63-tp73l-affinity-purified-polyclonal-ab-41202412401237.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")