![Immunohistochemistry-Paraffin: ADAR Antibody [NBP3-05523] - Analysis in human testis and skeletal muscle tissues using NBP3-05523 antibody. Corresponding ADAR RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/ADAR-Antibody-Immunohistochemistry-Paraffin-NBP3-05523-img0008.jpg "Immunohistochemistry-Paraffin: ADAR Antibody [NBP3-05523] - Analysis in human testis and skeletal muscle tissues using NBP3-05523 antibody. Corresponding ADAR RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: ALLTHFLQPIYLKSVTLGYLFSQGHLTRAICCRVTRDGSAFEDGLRHPFIVNHPKVGRVSIYDSKRQSGKTKETSVNWCLADGYDLEILDGTRGTVDGPRNELSRVSKKNIFLLFKKLCSFRYRRDLLRLSYGEAKKAARDY |
| Predicted Species | Mouse (93%), Rat (94%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ADAR |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | For ICC/IF fixation permeabilization use PFA/Triton X-100. IHC-P Retrieval method: HIER pH6. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, pH 7.2, containing 40% glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
![Western Blot PKLR Antibody [Unconjugated]](https://images.novusbio.com/images2/PKLR_AF8519_Western_Blot_16592.jpg)
![Simple Western PKLR Antibody [Unconjugated]](https://images.novusbio.com/images2/af8519_human-mouse-rat-pklr-affinity-purified-pab-simple-western-1342022154119.jpg)
![Western Blot beta-Catenin Antibody [Unconjugated]](https://images.novusbio.com/images2/beta-Catenin_AF1329_Western_Blot_5100.jpg)
![Chromatin Immunoprecipitation (ChIP) beta-Catenin Antibody [Unconjugated]](https://images.novusbio.com/images2/beta-Catenin_AF1329_Chromatin_Immunoprecipitation_11251.jpg)
![Simple Western beta-Catenin Antibody [Unconjugated]](https://images.novusbio.com/images2/betaCatenin_AF1329_Simple_Western_17134.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | ADAR |
![Immunohistochemistry-Paraffin: ADAR Antibody [NBP3-05523] - Staining of human cerebellum, endometrium, skeletal muscle and testis using Anti-ADAR antibody NBP3-05523 (A) shows similar protein distribution across tissues to independent antibody NBP1-90242 (B).](http://images.novusbio.com/fullsize/ADAR-Antibody-Immunohistochemistry-Paraffin-NBP3-05523-img0007.jpg "Immunohistochemistry-Paraffin: ADAR Antibody [NBP3-05523] - Staining of human cerebellum, endometrium, skeletal muscle and testis using Anti-ADAR antibody NBP3-05523 (A) shows similar protein distribution across tissues to independent antibody NBP1-90242 (B).")
![Immunocytochemistry/Immunofluorescence: ADAR Antibody [NBP3-05523] - Staining of human cell line U-2 OS shows localization to nucleoplasm & nucleoli.](http://images.novusbio.com/fullsize/ADAR-Antibody-Immunocytochemistry-Immunofluorescence-NBP3-05523-img0001.jpg "Immunocytochemistry/Immunofluorescence: ADAR Antibody [NBP3-05523] - Staining of human cell line U-2 OS shows localization to nucleoplasm & nucleoli.")
![Immunohistochemistry-Paraffin: ADAR Antibody [NBP3-05523] - Staining of human endometrium shows moderate nuclear positivity in glandular cells.](http://images.novusbio.com/fullsize/ADAR-Antibody-Immunohistochemistry-Paraffin-NBP3-05523-img0011.jpg "Immunohistochemistry-Paraffin: ADAR Antibody [NBP3-05523] - Staining of human endometrium shows moderate nuclear positivity in glandular cells.")
![Immunohistochemistry-Paraffin: ADAR Antibody [NBP3-05523] - Staining of human testis shows moderate to strong nuclear positivity in a subset of cells in seminiferous ducts.](http://images.novusbio.com/fullsize/ADAR-Antibody-Immunohistochemistry-Paraffin-NBP3-05523-img0009.jpg "Immunohistochemistry-Paraffin: ADAR Antibody [NBP3-05523] - Staining of human testis shows moderate to strong nuclear positivity in a subset of cells in seminiferous ducts.")
![Immunohistochemistry-Paraffin: ADAR Antibody [NBP3-05523] - Staining of human cerebellum shows strong nuclear positivity in all layers.](http://images.novusbio.com/fullsize/ADAR-Antibody-Immunohistochemistry-Paraffin-NBP3-05523-img0010.jpg "Immunohistochemistry-Paraffin: ADAR Antibody [NBP3-05523] - Staining of human cerebellum shows strong nuclear positivity in all layers.")
![Immunohistochemistry-Paraffin: ADAR Antibody [NBP3-05523] - Staining of human skeletal muscle shows no positivity in myocytes as expected.](http://images.novusbio.com/fullsize/ADAR-Antibody-Immunohistochemistry-Paraffin-NBP3-05523-img0012.jpg "Immunohistochemistry-Paraffin: ADAR Antibody [NBP3-05523] - Staining of human skeletal muscle shows no positivity in myocytes as expected.")
![Western Blot Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Western_Blot_5287.jpg)
![Simple Western Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Simple_Western_16990.jpg)
![Knockout Validated Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Knockout_Validated_24032.jpg)
![Western Blot BMP-1/PCP Antibody [Unconjugated]](https://images.novusbio.com/images2/BMP1_AF1927_Western_Blot_21018.jpg)
![Western Blot BMP-1/PCP Antibody [Unconjugated]](https://images.novusbio.com/images2/BMP1_AF1927_Western_Blot_21019.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")