Home » actin, gamma 2 » actin, gamma 2 Proteins » Recombinant Human actin, gamma 2 GST (N-Term) Protein
Novus Biologicals products are now on bio-techne.com

Recombinant Human actin, gamma 2 GST (N-Term) Protein

 Submit a Review

Images

 
(
Enlarge)
SDS-Page: Recombinant Human actin, gamma 2 Protein [H00000072-P02] - 12.5% SDS-PAGE Stained with Coomassie Blue.
SDS-Page: Recombinant Human actin, gamma 2 Protein [H00000072-P02] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, AP

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Recombinant Human actin, gamma 2 GST (N-Term) Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-376 of Human ACTG2

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MCEEETTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSLEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKPEYDEAGPSIVHRKCF
Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
ACTG2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
68.3 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human actin, gamma 2 GST (N-Term) Protein

  • ACT
  • ACTA3alpha-actin 3
  • ACTE
  • actin, gamma 2, smooth muscle, enteric
  • actin, gamma-enteric smooth muscle
  • ACTL3
  • ACTSGactin-like protein
  • alpha-actin-3
  • gamma-2-actin
  • smooth muscle gamma actin
  • Smooth muscle gamma-actin

Background

Actins are highly conserved proteins that are involved in various types of cell motility, and maintenance of the cytoskeleton. In vertebrates, three main groups of actin isoforms, alpha, beta and gamma have been identified. The alpha actins are found in muscle tissues and are a major constituent of the contractile apparatus. The beta and gamma actins co-exist in most cell types as components of the cytoskeleton, and as mediators of internal cell motility. Actin, gamma 2, encoded by this gene, is a smooth muscle actin found in enteric tissues. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Kallikrein 3/PSA
[HRP]
DKK300
N/A Kallikrein 3/PSA [HRP]
N/A Kallikrein 3/PSA [HRP]
N/A Kallikrein 3/PSA [HRP]
(17 Publications)
Species: Hu
Applications: ELISA
Carboxypeptidase
B1/CPB1 Antibody
NBP2-15698
Western Blot Carboxypeptidase B1/CPB1 Antibody
Western Blot Carboxypeptidase B1/CPB1 Antibody
Western Blot Carboxypeptidase B1/CPB1 Antibody
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Prothrombin
Antibody
NBP1-58268
Immunohistochemistry-Paraffin Prothrombin Antibody
Immunohistochemistry-Paraffin Prothrombin Antibody
Western Blot Prothrombin Antibody
(1 Review)
(3 Publications)
Species: Hu, Mu
Applications: IHC, IHC-P, WB
C-Reactive
Protein/CRP [Biotin]
DY1707
N/A C-Reactive Protein/CRP [Biotin]
(67 Publications)
Species: Hu
Applications: ELISA
Serpin A3/alpha
1-Antichymotrypsin An ...
NBP2-52559
Western Blot Serpin A3/alpha 1-Antichymotrypsin Antibody (5G3C11) - BSA Free
ELISA Serpin A3/alpha 1-Antichymotrypsin Antibody (5G3C11) - BSA Free
Flow Cytometry Serpin A3/alpha 1-Antichymotrypsin Antibody (5G3C11) - BSA Free
(1 Publication)
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IHC, IHC-P, WB
Apolipoprotein
E/ApoE Antibody (WUE- ...
NB110-60531
Flow (Intracellular) Apolipoprotein E/ApoE Antibody (WUE-4) - BSA Free
Western Blot Apolipoprotein E/ApoE Antibody (WUE-4) - BSA Free
Flow Cytometry Apolipoprotein E/ApoE Antibody (WUE-4) - BSA Free
(2 Reviews)
(38 Publications)
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, WB
Serpin
C1/Antithrombin-III A ...
AF1267
Serpin C1/Antithrombin-III Antibody [Unconjugated]
(5 Publications)
Species: Hu
Applications: IP, Neut, WB
IL-6 [HRP]
M6000B
N/A IL-6 [HRP]
N/A IL-6 [HRP]
N/A IL-6 [HRP]
(639 Publications)
Species: Mu
Applications: ELISA
PSAT1 Antibody
NBP1-32920
Western Blot PSAT1 Antibody
Immunocytochemistry/ Immunofluorescence PSAT1 Antibody
Immunohistochemistry-Paraffin PSAT1 Antibody
(12 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Protein S/PROS1
Antibody [Unconjugate
AF4036
Western Blot Protein S/PROS1 Antibody [Unconjugated]
Simple Western Protein S/PROS1 Antibody [Unconjugated]
(7 Publications)
Species: Hu
Applications: Simple Western, WB
PLAG1 Antibody
(3B7)
H00005324-M02
Immunohistochemistry PLAG1 Antibody (3B7)
Immunohistochemistry PLAG1 Antibody (3B7)
ELISA PLAG1 Antibody (3B7)
(20 Publications)
Species: Hu, Mu
Applications: ELISA, IHC, IHC-P, WB

Puromycin-sensitive am ...
NBP2-13669
Immunohistochemistry-Paraffin Puromycin-sensitive aminopeptidase/NPEPPS Antibody
Immunohistochemistry Puromycin-sensitive aminopeptidase/NPEPPS Antibody
Immunohistochemistry-Paraffin Puromycin-sensitive aminopeptidase/NPEPPS Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P
beta Amyloid
Antibody (MOAB-2) - B ...
NBP2-13075
Immunohistochemistry-Frozen beta Amyloid Antibody (MOAB-2) - BSA Free
Immunohistochemistry beta Amyloid Antibody (MOAB-2) - BSA Free
Immunocytochemistry/ Immunofluorescence beta Amyloid Antibody (MOAB-2) - BSA Free
(2 Reviews)
(69 Publications)
Species: Ba, Hu, Pm, Mu, Rt
Applications: DB, ELISA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, WB
CSRP1 Antibody
AF5739
Western Blot CSRP1 Antibody
Species: Hu, Mu, Rt
Applications: WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(808 Publications)
Species: Hu
Applications: BA
TFF2 Antibody
(366508) [Unconjugate
MAB4077
Immunohistochemistry TFF2 Antibody (366508) [Unconjugated]
(1 Publication)
Species: Hu
Applications: IHC, WB
Serpin A5/Protein
C Inhibitor Antibody ...
MAB1266
Intracellular Staining by Flow Cytometry Serpin A5/Protein C Inhibitor Antibody (210326) [Unconjugated]
(2 Publications)
Species: Hu
Applications: CyTOF-ready, IP, ICFlow, WB
Serpin A1/alpha
1-Antitrypsin Antibod ...
MAB1268
Western Blot Serpin A1/alpha 1-Antitrypsin Antibody (202808) [Unconjugated]
Simple Western Serpin A1/alpha 1-Antitrypsin Antibody (202808) [Unconjugated]
Immunocytochemistry Serpin A1/alpha 1-Antitrypsin Antibody (202808) [Unconjugated]
(1 Review)
(13 Publications)
Species: Hu
Applications: ICC, IHC, IP, Simple Western, WB
Presenilin-1
Antibody (APS 18)
NB100-74510
Western Blot Presenilin-1 Antibody (APS 18)
Immunocytochemistry/ Immunofluorescence Presenilin-1 Antibody (APS 18)
Immunocytochemistry/ Immunofluorescence Presenilin-1 Antibody (APS 18)
(1 Review)
(5 Publications)
Species: Hu, Mu, Pm, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
Recombinant Human
actin, gamma 2 GST (N ...
H00000072-P02
Recombinant Human actin, gamma 2 GST (N-Term) Protein
Species: Hu
Applications: WB, ELISA, MA, AP

Publications for actin, gamma 2 Recombinant Protein (H00000072-P02) (0)

There are no publications for actin, gamma 2 Recombinant Protein (H00000072-P02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for actin, gamma 2 Recombinant Protein (H00000072-P02) (0)

There are no reviews for actin, gamma 2 Recombinant Protein (H00000072-P02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for actin, gamma 2 Recombinant Protein (H00000072-P02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional actin, gamma 2 Products

Blogs on actin, gamma 2

There are no specific blogs for actin, gamma 2, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human actin, gamma 2 GST (N-Term) Protein and receive a gift card or discount.


Bioinformatics

Gene Symbol ACTG2