Novus Biologicals products are now on bio-techne.com

5'-Nucleotidase/CD73 Recombinant Protein Antigen

Images

 
There are currently no images for 5'-Nucleotidase/CD73 Protein (NBP1-85740PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

5'-Nucleotidase/CD73 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NT5E.

Source: E. coli

Amino Acid Sequence: EFDNGVEGLIEPLLKEAKFPILSANIKAKGPLASQISGLYLPYKVLPVGDEVVGIVGYTSKETPFLSNPGTNLVFEDEITALQPEVDKLKTLNVNKIIALGHSGFEMDKLIAQK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
NT5E
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-85740.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for 5'-Nucleotidase/CD73 Recombinant Protein Antigen

  • 5' nucleotidase (CD73)
  • 5'-NT
  • 5-NT
  • 5'-Nucleotidase
  • 5'-nucleotidase, ecto (CD73)
  • CD73 antigen
  • CD73
  • E5NT
  • EC 3.1.3.5
  • ecto-5'-nucleotidase
  • eN
  • eNT
  • NT
  • NT55'-nucleotidase
  • NT5E
  • NTE
  • Purine 5-Prime-Nucleotidase

Background

Ecto-5-prime-nucleotidase (5-prime-ribonucleotide phosphohydrolase; EC 3.1.3.5) catalyzes the conversion at neutral pH of purine 5-prime mononucleotides to nucleosides, the preferred substrate being AMP. The enzyme consists of a dimer of 2 identical 70-kD subunits bound by a glycosyl phosphatidyl inositol linkage to the external face of the plasma membrane. The enzyme is used as a marker of lymphocyte differentiation. Consequently, a deficiency of NT5 occurs in a variety of immunodeficiency diseases (e.g., see MIM 102700, MIM 300300). Other forms of 5-prime nucleotidase exist in the cytoplasm and lysosomes and can be distinguished from ecto-NT5 by their substrate affinities, requirement for divalent magnesium ion, activation by ATP, and inhibition by inorganic phosphate.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-33903
Species: Hu
Applications: IHC, IHC-P
NBP1-87404
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, KD, WB
7268-CT
Species: Hu
Applications: BA
AF1320
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
DBD00
Species: Hu
Applications: ELISA
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NB100-1519
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC-FrFl, PEP-ELISA, WB
AF2067
Species: Ca, Hu, Po
Applications: CyTOF-ready, Flow, ICC, IHC, WB
AF114
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, WB
H00010908-M08
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
AF4117
Species: Rt
Applications: IHC, WB
NBP1-90071
Species: Eq, Hu, Mu, Po
Applications: Flow, ICC/IF, IHC, IHC-P, WB
MAB4375
Species: Hu, Mu, Rt
Applications: IHC
267-N3
Species: Hu
Applications: BA
NBP2-15291
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
BBA10
Species: Hu
Applications: CyTOF-ready, Flow, IHC, IP, Simple Western, WB
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow

Publications for 5'-Nucleotidase/CD73 Protein (NBP1-85740PEP) (0)

There are no publications for 5'-Nucleotidase/CD73 Protein (NBP1-85740PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for 5'-Nucleotidase/CD73 Protein (NBP1-85740PEP) (0)

There are no reviews for 5'-Nucleotidase/CD73 Protein (NBP1-85740PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for 5'-Nucleotidase/CD73 Protein (NBP1-85740PEP). (Showing 1 - 1 of 1 FAQ).

  1. We are interested in CD73 antibodies that could react with dog, please let me know which products in your catalog you would recommend.
    • We do not currently carry any CD73 antibodies that have been validated for use in dog samples. However, if you are interested in testing any of our CD73 antibodies with dog samples you would be eligible for our Innovators Reward Program, in which you can get a discount voucher for the purchase price of the product. Please contact us at innovators@novusbio.com with any questions regarding this program.

Additional 5'-Nucleotidase/CD73 Products

Research Areas for 5'-Nucleotidase/CD73 Protein (NBP1-85740PEP)

Find related products by research area.

Blogs on 5'-Nucleotidase/CD73.

Adenosine Inhibits T cell Tumor Infiltration: KCa3.1, a New Anticancer Target
By Yoskaly Lazo-Fernandez, PhD Role of Adenosine in the Tumor Microenvironment a Target for Cancer TherapyThe tumor microenvironment (TME) tends to be concentrated in the purine nucleoside adenosine, a direct resu...  Read full blog post.

CD73 (Cluster of differentiation 73, ecto-5'-nucleotidase)
CD73 is a 70kD glycosyl-phosphatidylinositol (GPI)-anchored cell surface molecule that belongs to the 5'-nucleosidase family. It hydrolyzes extracellular nucleotides into membrane permeable nucleosides and is found as both a membrane-bound and soluble...  Read full blog post.

Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our 5'-Nucleotidase/CD73 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol NT5E