![Immunocytochemistry/Immunofluorescence: ZNF3 Antibody [NBP1-89329] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.](http://images.novusbio.com/fullsize/ZNF3-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-89329-img0013.jpg "Immunocytochemistry/Immunofluorescence: ZNF3 Antibody [NBP1-89329] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.")
| Reactivity | Hu, MuSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: SALPSKVPAFSDKDSLGDEMLAAALLKAKSQELVTFEDVAVYFIRKEWKRLEPAQRDLYRDVMLENYGNVFSLDRETRTENDQEISEDTRSHGVLLGRFQKDISQGLKFKEAYEREVSLKRPLGNSPGERLNRK |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ZNF3 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot STAT1 [p Tyr701] Antibody [Unconjugated]](https://images.novusbio.com/images2/STAT1_AF2894_Western_Blot_5226.jpg)
![Simple Western STAT1 [p Tyr701] Antibody [Unconjugated]](https://images.novusbio.com/images2/16351.jpg)
![Intracellular Staining by Flow Cytometry STAT1 [p Tyr701] Antibody [Unconjugated]](https://images.novusbio.com/images2/STAT1_AF2894_Flow_Cytometry_8189.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | ZNF3 |
![Immunohistochemistry-Paraffin: ZNF3 Antibody [NBP1-89329] - Staining of human cerebellum shows nuclear positivity in Purkinje cells, as well as in the molecular and granular cell layers.](http://images.novusbio.com/fullsize/ZNF3-Antibody-Immunohistochemistry-Paraffin-NBP1-89329-img0012.jpg "Immunohistochemistry-Paraffin: ZNF3 Antibody [NBP1-89329] - Staining of human cerebellum shows nuclear positivity in Purkinje cells, as well as in the molecular and granular cell layers.")
![Immunocytochemistry/Immunofluorescence: ZNF3 Antibody [NBP1-89329] - Staining of mouse midbrain shows nuclear staining in neurons of the oculomotor and red nuclei.](http://images.novusbio.com/fullsize/ZNF3-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-89329-img0005.jpg "Immunocytochemistry/Immunofluorescence: ZNF3 Antibody [NBP1-89329] - Staining of mouse midbrain shows nuclear staining in neurons of the oculomotor and red nuclei.")
![Immunocytochemistry/Immunofluorescence: ZNF3 Antibody [NBP1-89329] - Staining of mouse piriform cortex shows nuclear staining in the neurons of layer 2.](http://images.novusbio.com/fullsize/ZNF3-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-89329-img0007.jpg "Immunocytochemistry/Immunofluorescence: ZNF3 Antibody [NBP1-89329] - Staining of mouse piriform cortex shows nuclear staining in the neurons of layer 2.")
![Immunocytochemistry/Immunofluorescence: ZNF3 Antibody [NBP1-89329] - Staining of mouse hypothalamus shows nuclear positivity in the neurons of medial preoptic area.](http://images.novusbio.com/fullsize/ZNF3-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-89329-img0008.jpg "Immunocytochemistry/Immunofluorescence: ZNF3 Antibody [NBP1-89329] - Staining of mouse hypothalamus shows nuclear positivity in the neurons of medial preoptic area.")
![Immunocytochemistry/Immunofluorescence: ZNF3 Antibody [NBP1-89329] - Staining of mouse hypothalamus shows nuclear immunoreactivity in the neurons in the arcuate nucleus.](http://images.novusbio.com/fullsize/ZNF3-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-89329-img0009.jpg "Immunocytochemistry/Immunofluorescence: ZNF3 Antibody [NBP1-89329] - Staining of mouse hypothalamus shows nuclear immunoreactivity in the neurons in the arcuate nucleus.")
![Immunocytochemistry/Immunofluorescence: ZNF3 Antibody [NBP1-89329] - Staining of mouse visual cortex shows nuclear positivity in neurons.](http://images.novusbio.com/fullsize/ZNF3-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-89329-img0010.jpg "Immunocytochemistry/Immunofluorescence: ZNF3 Antibody [NBP1-89329] - Staining of mouse visual cortex shows nuclear positivity in neurons.")
![Immunohistochemistry-Paraffin: ZNF3 Antibody [NBP1-89329] - Staining of human duodenum shows strong nuclear positivity in glandular cells.](http://images.novusbio.com/fullsize/ZNF3-Antibody-Immunohistochemistry-Paraffin-NBP1-89329-img0002.jpg "Immunohistochemistry-Paraffin: ZNF3 Antibody [NBP1-89329] - Staining of human duodenum shows strong nuclear positivity in glandular cells.")
![Immunohistochemistry-Paraffin: ZNF3 Antibody [NBP1-89329] - Staining of human cerebral cortex shows nuclear positivity in neuronal cells.](http://images.novusbio.com/fullsize/ZNF3-Antibody-Immunohistochemistry-Paraffin-NBP1-89329-img0006.jpg "Immunohistochemistry-Paraffin: ZNF3 Antibody [NBP1-89329] - Staining of human cerebral cortex shows nuclear positivity in neuronal cells.")
![Immunohistochemistry-Paraffin: ZNF3 Antibody [NBP1-89329] - Staining of human cerebral cortex shows strong nuclear immunoreactivity in neurons.](http://images.novusbio.com/fullsize/ZNF3-Antibody-Immunohistochemistry-Paraffin-NBP1-89329-img0011.jpg "Immunohistochemistry-Paraffin: ZNF3 Antibody [NBP1-89329] - Staining of human cerebral cortex shows strong nuclear immunoreactivity in neurons.")
![SDS-PAGE ErbB2/Her2 [Unconjugated]](https://images.novusbio.com/images2/ErbB2_1129-ER_70.jpg)
![Bioactivity ErbB2/Her2 [Unconjugated]](https://images.novusbio.com/images2/1129-er_recombinant-human-erbb2-her2-fc-chimera-protein-cf-bioactivity-7122020142841.jpg)
![Immunocytochemistry/ Immunofluorescence HAPLN1 Antibody [Unconjugated]](https://images.novusbio.com/images/af2608_human-hapln1-affinity-purified-polyclonal-ab-41202412401260.jpg)
![Immunocytochemistry/ Immunofluorescence HAPLN1 Antibody [Unconjugated]](https://images.novusbio.com/images/af2608_human-hapln1-affinity-purified-polyclonal-ab-4120241240223.jpg)
![Immunocytochemistry/ Immunofluorescence HAPLN1 Antibody [Unconjugated]](https://images.novusbio.com/images/af2608_human-hapln1-affinity-purified-polyclonal-ab-4120241239497.jpg)
![Immunohistochemistry CXCL13/BLC/BCA-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/CXCL13_AF470_Immunohistochemistry_10193.jpg)
![Neutralization CXCL13/BLC/BCA-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/CXCL13_AF470_Block_Neutralize_8888.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")