![Western Blot: ZNF24 Antibody [NBP1-82866] - Analysis in human cell line SCLC-21H.](http://images.novusbio.com/fullsize/ZNF24-Antibody-Western-Blot-NBP1-82866-img0009.jpg "Western Blot: ZNF24 Antibody [NBP1-82866] - Analysis in human cell line SCLC-21H.")
| Reactivity | Hu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC, KD |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LESELDDPGQPVSLRRRKREVLVEDMVSQEEAQGLPSSELDAVENQLKWASWELHSLRHCDDDGRTENGALAPKQELPSALESHEVPGTLSMGVPQIFKYGETCFPKGRFERKRNPSRKKQHICDECGKHFS |
| Predicted Species | Rat (91%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ZNF24 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Reviewed Applications |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot beta-Catenin Antibody [Unconjugated]](https://images.novusbio.com/images2/beta-Catenin_AF1329_Western_Blot_5100.jpg)
![Chromatin Immunoprecipitation (ChIP) beta-Catenin Antibody [Unconjugated]](https://images.novusbio.com/images2/beta-Catenin_AF1329_Chromatin_Immunoprecipitation_11251.jpg)
![Simple Western beta-Catenin Antibody [Unconjugated]](https://images.novusbio.com/images2/betaCatenin_AF1329_Simple_Western_17134.jpg)
| Publications using NBP1-82866 | Applications | Species |
|---|---|---|
| Dong G, Huang X, Chen R et al. Increased PD-L1 Restricts Liver Injury in Nonalcoholic Fatty Liver Disease Oxidative Medicine and Cellular Longevity 2022-05-16 [PMID: 35615575] (Immunohistochemistry, Immunoprecipitation, Western Blot) | Immunohistochemistry, Immunoprecipitation, Western Blot | |
| Lopez-Contreras AJ, Ruppen I, Nieto-Soler M et al. A Proteomic Characterization of Factors Enriched at Nascent DNA Molecules Cell Rep 2013-03-26 [PMID: 23545495] (WB, Human) | WB | Human |
| Images | Ratings | Applications | Species | Date | Details | ||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Andres J Lopez-Contreras |
WB | Human | 06/03/2013 |
Summary
|
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | ZNF24 |
![Immunocytochemistry/Immunofluorescence: ZNF24 Antibody [NBP1-82866] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleus.](http://images.novusbio.com/fullsize/ZNF24-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-82866-img0007.jpg "Immunocytochemistry/Immunofluorescence: ZNF24 Antibody [NBP1-82866] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleus.")
![Immunohistochemistry-Paraffin: ZNF24 Antibody [NBP1-82866] - Staining of human lymph node shows strong cytoplasmic and nuclear positivity in subsets of cells.](http://images.novusbio.com/fullsize/ZNF24-Antibody-Immunohistochemistry-Paraffin-NBP1-82866-img0001.jpg "Immunohistochemistry-Paraffin: ZNF24 Antibody [NBP1-82866] - Staining of human lymph node shows strong cytoplasmic and nuclear positivity in subsets of cells.")
![Western Blot: ZNF24 Antibody [NBP1-82866] - Analysis in U2OS and HEK cells. siRNA against ZNF24 show the specificity of the antibody. ZNF24 was used 1/500 in TBST 5% milk, 1 hour at room temperature. Image submitted by a verified customer review.](http://images.novusbio.com/fullsize/ZNF24-Antibody-Western-Blot-NBP1-82866-img0005.jpg "Western Blot: ZNF24 Antibody [NBP1-82866] - Analysis in U2OS and HEK cells. siRNA against ZNF24 show the specificity of the antibody. ZNF24 was used 1/500 in TBST 5% milk, 1 hour at room temperature. Image submitted by a verified customer review.")
![Western Blot: ZNF24 Antibody [NBP1-82866] - ZNF24 promoted PD-L1 expression through binding to its promoter in FFA-treated LO2 cells. ZNF24 and PD-L1 expression in LO2 cells pretreated with siRNA against ZNF24, followed by FFA treatment detected by western blot. ∗∗P < 0.01. PD-L1 expression was suppressed following the ZNF24 knockdown. Image collected and cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/35615575/) licensed under a CC-BY license.](http://images.novusbio.com/fullsize/antibody/nbp1-82866_rabbit-polyclonal-znf24-antibody-knockdown-validated-20920231837.jpg "Western Blot: ZNF24 Antibody [NBP1-82866] - ZNF24 promoted PD-L1 expression through binding to its promoter in FFA-treated LO2 cells. ZNF24 and PD-L1 expression in LO2 cells pretreated with siRNA against ZNF24, followed by FFA treatment detected by western blot. ∗∗P < 0.01. PD-L1 expression was suppressed following the ZNF24 knockdown. Image collected and cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/35615575/) licensed under a CC-BY license.")
![Western Blot: ZNF24 Antibody [NBP1-82866] - ZNF24 promoted PD-L1 expression through binding to its promoter in FFA-treated LO2 cells. (a) A schematic of the target sites (wild & mutant) of ZNF24 in the promoter of PD-L1. (b–d) Dual-luciferase reporter assays performed in LO2 cells transfected with WT or MT plasmid containing ZNF24-binding sites in the PD-L1 promoter using Lipofectamine 2000 after ZNF24 overexpression. (e–g) ZNF24 expression after FFA treatment determined by qRT-PCR & western blot. (h & i) ZNF24 expression in LO2 cells pretreated with siRNA against NOX4, MitoTEMPO (10 μM), or NAC (5 mM) followed by FFA treatment, measured by western blot. (j & k) ZNF24 & PD-L1 expression in LO2 cells pretreated with siRNA against ZNF24, followed by FFA treatment detected by western blot. ∗∗P < 0.01. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/35615575), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp1-82866_rabbit-polyclonal-znf24-antibody-310202415395912.jpg "Western Blot: ZNF24 Antibody [NBP1-82866] - ZNF24 promoted PD-L1 expression through binding to its promoter in FFA-treated LO2 cells. (a) A schematic of the target sites (wild & mutant) of ZNF24 in the promoter of PD-L1. (b–d) Dual-luciferase reporter assays performed in LO2 cells transfected with WT or MT plasmid containing ZNF24-binding sites in the PD-L1 promoter using Lipofectamine 2000 after ZNF24 overexpression. (e–g) ZNF24 expression after FFA treatment determined by qRT-PCR & western blot. (h & i) ZNF24 expression in LO2 cells pretreated with siRNA against NOX4, MitoTEMPO (10 μM), or NAC (5 mM) followed by FFA treatment, measured by western blot. (j & k) ZNF24 & PD-L1 expression in LO2 cells pretreated with siRNA against ZNF24, followed by FFA treatment detected by western blot. ∗∗P < 0.01. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/35615575), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Western Blot: ZNF24 Antibody [NBP1-82866] - ZNF24 promoted PD-L1 expression through binding to its promoter in FFA-treated LO2 cells. (a) A schematic of the target sites (wild & mutant) of ZNF24 in the promoter of PD-L1. (b–d) Dual-luciferase reporter assays performed in LO2 cells transfected with WT or MT plasmid containing ZNF24-binding sites in the PD-L1 promoter using Lipofectamine 2000 after ZNF24 overexpression. (e–g) ZNF24 expression after FFA treatment determined by qRT-PCR & western blot. (h & i) ZNF24 expression in LO2 cells pretreated with siRNA against NOX4, MitoTEMPO (10 μM), or NAC (5 mM) followed by FFA treatment, measured by western blot. (j & k) ZNF24 & PD-L1 expression in LO2 cells pretreated with siRNA against ZNF24, followed by FFA treatment detected by western blot. ∗∗P < 0.01. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/35615575), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp1-82866_rabbit-polyclonal-znf24-antibody-310202415171324.jpg "Western Blot: ZNF24 Antibody [NBP1-82866] - ZNF24 promoted PD-L1 expression through binding to its promoter in FFA-treated LO2 cells. (a) A schematic of the target sites (wild & mutant) of ZNF24 in the promoter of PD-L1. (b–d) Dual-luciferase reporter assays performed in LO2 cells transfected with WT or MT plasmid containing ZNF24-binding sites in the PD-L1 promoter using Lipofectamine 2000 after ZNF24 overexpression. (e–g) ZNF24 expression after FFA treatment determined by qRT-PCR & western blot. (h & i) ZNF24 expression in LO2 cells pretreated with siRNA against NOX4, MitoTEMPO (10 μM), or NAC (5 mM) followed by FFA treatment, measured by western blot. (j & k) ZNF24 & PD-L1 expression in LO2 cells pretreated with siRNA against ZNF24, followed by FFA treatment detected by western blot. ∗∗P < 0.01. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/35615575), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Western Blot: ZNF24 Antibody [NBP1-82866] - Identification of ZNF24–UBE2I protein interactions. (a & b) Analysis of protein interactions between ZNF24 & UBE2I using the BioGRID database, further confirmed by Co-IP assays. (c–f) UBE2I expression in LO2 cells treated by FFA or pretreated with siRNA against NOX4, MitoTEMPO (10 μM), or NAC (5 mM) followed by FFA treatment measured by western blot. (g & h) After FFA treatment, Sumo-1: ZNF24 & ZNF24 expression levels detected by western blot. (i & j) After UBE2I overexpression, Sumo-1: ZNF24, ZNF24, PD-L1, & UBE2I expression levels were determined by western blot. (k–m) Dual-luciferase reporter assays performed in LO2 cells transfected with WT plasmid containing ZNF24-binding sites in the PD-L1 promoter using Lipofectamine 2000 after ZNF24 overexpression with or without Sumo-1 overexpression. ∗∗P < 0.01. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/35615575), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp1-82866_rabbit-polyclonal-znf24-antibody-310202416121921.jpg "Western Blot: ZNF24 Antibody [NBP1-82866] - Identification of ZNF24–UBE2I protein interactions. (a & b) Analysis of protein interactions between ZNF24 & UBE2I using the BioGRID database, further confirmed by Co-IP assays. (c–f) UBE2I expression in LO2 cells treated by FFA or pretreated with siRNA against NOX4, MitoTEMPO (10 μM), or NAC (5 mM) followed by FFA treatment measured by western blot. (g & h) After FFA treatment, Sumo-1: ZNF24 & ZNF24 expression levels detected by western blot. (i & j) After UBE2I overexpression, Sumo-1: ZNF24, ZNF24, PD-L1, & UBE2I expression levels were determined by western blot. (k–m) Dual-luciferase reporter assays performed in LO2 cells transfected with WT plasmid containing ZNF24-binding sites in the PD-L1 promoter using Lipofectamine 2000 after ZNF24 overexpression with or without Sumo-1 overexpression. ∗∗P < 0.01. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/35615575), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Western Blot: ZNF24 Antibody [NBP1-82866] - Identification of ZNF24–UBE2I protein interactions. (a & b) Analysis of protein interactions between ZNF24 & UBE2I using the BioGRID database, further confirmed by Co-IP assays. (c–f) UBE2I expression in LO2 cells treated by FFA or pretreated with siRNA against NOX4, MitoTEMPO (10 μM), or NAC (5 mM) followed by FFA treatment measured by western blot. (g & h) After FFA treatment, Sumo-1: ZNF24 & ZNF24 expression levels detected by western blot. (i & j) After UBE2I overexpression, Sumo-1: ZNF24, ZNF24, PD-L1, & UBE2I expression levels were determined by western blot. (k–m) Dual-luciferase reporter assays performed in LO2 cells transfected with WT plasmid containing ZNF24-binding sites in the PD-L1 promoter using Lipofectamine 2000 after ZNF24 overexpression with or without Sumo-1 overexpression. ∗∗P < 0.01. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/35615575), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp1-82866_rabbit-polyclonal-znf24-antibody-31020241612241.jpg "Western Blot: ZNF24 Antibody [NBP1-82866] - Identification of ZNF24–UBE2I protein interactions. (a & b) Analysis of protein interactions between ZNF24 & UBE2I using the BioGRID database, further confirmed by Co-IP assays. (c–f) UBE2I expression in LO2 cells treated by FFA or pretreated with siRNA against NOX4, MitoTEMPO (10 μM), or NAC (5 mM) followed by FFA treatment measured by western blot. (g & h) After FFA treatment, Sumo-1: ZNF24 & ZNF24 expression levels detected by western blot. (i & j) After UBE2I overexpression, Sumo-1: ZNF24, ZNF24, PD-L1, & UBE2I expression levels were determined by western blot. (k–m) Dual-luciferase reporter assays performed in LO2 cells transfected with WT plasmid containing ZNF24-binding sites in the PD-L1 promoter using Lipofectamine 2000 after ZNF24 overexpression with or without Sumo-1 overexpression. ∗∗P < 0.01. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/35615575), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/DATA_IL6_M6000_ELISA_936.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/IL-6_M6000_ELISA_415.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images/m6000b_mouse-il-6-quantikine-elisa-kit-44202415433118.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/DATA_VEGF_DVE00_ELISA_871.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/DATA_VEGF_DVE00_ELISA_872.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/VEGF_DVE00_ELISA_208.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")
