![Western Blot: WT1 Antibody (6L9X6) [NBP3-16135] - Western blot analysis of extracts of Rat testis, using WT1 antibody (NBP3-16135) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.](http://images.novusbio.com/fullsize/WT1-Antibody-6L9X6-Western-Blot-NBP3-16135-img0006.jpg "Western Blot: WT1 Antibody (6L9X6) [NBP3-16135] - Western blot analysis of extracts of Rat testis, using WT1 antibody (NBP3-16135) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ELISA, IHC |
| Clone | 6L9X6 |
| Clonality | Monoclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Additional Information | Recombinant Monoclonal Antibody |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 60-250 of human WT1 (P19544). PPPPPPPPPHSFIKQEPSWGGAEPHEEQCLSAFTVHFSGQFTGTAGACRYGPFGPPPPSQASSGQARMFPNAPYLPSCLESQPAIRNQGYSTVTFDGTPSYGHTPSHHAAQFPNHSFKHEDPMGQQGSLGEQQYSVPPPVYGCHTPTDSCTGSQALLLRTPYSSDNLYQMTSQLECMTWNQMNLGATLKGV |
| Isotype | IgG |
| Clonality | Monoclonal |
| Host | Rabbit |
| Gene | WT1 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Theoretical MW | 49 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for WT1 Antibody (NBP3-16135)Find related products by research area.
|
|
Routine WT1 Antibody Screen Uncovers an Exciting New Cancer-Cleaning Enzyme Enzyme antibodies are widely used in both apoptosis and cancer studies, as disruption of the proteins regulating apoptosis is known to lead to formation of tumor cells in certain cancers. We at Novus Biologicals are continually growing our enzyme anti... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | WT1 |
![Western Blot: WT1 Antibody (6L9X6) [NBP3-16135] - Western blot analysis of lysates from Mouse testis using WT1 Rabbit mAb at 1:1000 dilution incubated overnight at 4C.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.](http://images.novusbio.com/fullsize/nbp3-16135_rabbit-wt1-mab-6l9x6-5220251242594.jpg "Western Blot: WT1 Antibody (6L9X6) [NBP3-16135] - Western blot analysis of lysates from Mouse testis using WT1 Rabbit mAb at 1:1000 dilution incubated overnight at 4C.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.")
![Western Blot: WT1 Antibody (6L9X6) [NBP3-16135] - Western blot analysis of various lysates using WT1 Rabbit mAb at 1:1000 dilution incubated overnight at 4C.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 1s.](http://images.novusbio.com/fullsize/nbp3-16135_rabbit-wt1-mab-6l9x6-522025125482.jpg "Western Blot: WT1 Antibody (6L9X6) [NBP3-16135] - Western blot analysis of various lysates using WT1 Rabbit mAb at 1:1000 dilution incubated overnight at 4C.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 1s.")
![Immunohistochemistry-Paraffin: WT1 Antibody (6L9X6) [NBP3-16135] - Human Ovarian Serous Carcinoma tissue using WT1 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-16135_rabbit-wt1-mab-6l9x6-immunohistochemistry-paraffin-2882024111235..jpg "Immunohistochemistry-Paraffin: WT1 Antibody (6L9X6) [NBP3-16135] - Human Ovarian Serous Carcinoma tissue using WT1 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IHC staining.")
![Immunohistochemistry-Paraffin: WT1 Antibody (6L9X6) [NBP3-16135] - Human kidney tissue using WT1 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-16135_rabbit-wt1-mab-6l9x6-immunohistochemistry-paraffin-2882024111344..jpg "Immunohistochemistry-Paraffin: WT1 Antibody (6L9X6) [NBP3-16135] - Human kidney tissue using WT1 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining.")
![Immunohistochemistry: WT1 Antibody (6L9X6) [NBP3-16135] - Immunohistochemistry analysis of paraffin-embedded Human testis tissue using WT1 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-16135_rabbit-wt1-mab-6l9x6-52202511361241.jpg "Immunohistochemistry: WT1 Antibody (6L9X6) [NBP3-16135] - Immunohistochemistry analysis of paraffin-embedded Human testis tissue using WT1 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining.")
![Immunocytochemistry EGR1 Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af2818_human-egr1-affinity-purified-polyclonal-ab-immunocytochemistry-3102024831..jpg)
![Immunocytochemistry Pax2 Antibody [Unconjugated]](https://images.novusbio.com/images2/Pax2_AF3364_Immunocytochemistry_14405.jpg)
![Western Blot Pax2 Antibody [Unconjugated]](https://images.novusbio.com/images2/af3364_human-pax2-affinity-purified-polyclonal-ab-western-blot-145202183852.jpg)
![Immunohistochemistry Pax2 Antibody [Unconjugated]](https://images.novusbio.com/images2/af3364_human-pax2-affinity-purified-polyclonal-ab-immunohistochemistry-192021142455.jpg)
![Flow Cytometry Flt-3/Flk-2/CD135 Antibody (66903) [Unconjugated]](https://images.novusbio.com/images/antibody/mab812_human-flt-3-flk-2-mab-clone-66903-flow-cytometry-3112023131157..jpg)
![Flow Cytometry Flt-3/Flk-2/CD135 Antibody (66903) [Unconjugated]](https://images.novusbio.com/images/antibody/mab812_human-flt-3-flk-2-mab-clone-66903-flow-cytometry-3112023131255..jpg)
![SDS-PAGE IGF-II/IGF2 [Unconjugated]](https://images.novusbio.com/images2/IGF-II_292-G2_668.jpg)
![Bioactivity IGF-II/IGF2 [Unconjugated]](https://images.novusbio.com/images2/IGF-II_292-G2_669.jpg)
![Immunohistochemistry Nephrin Antibody [Unconjugated]](https://images.novusbio.com/images2/Nephrin_AF3159_Immunohistochemistry_6775.jpg)
![Immunohistochemistry Nephrin Antibody [Unconjugated]](https://images.novusbio.com/images2/Nephrin_AF3159_Immunohistochemistry_10004.jpg)
![Immunocytochemistry/ Immunofluorescence Nephrin Antibody [Unconjugated]](https://images.novusbio.com/images/af3159_mouse-nephrin-affinity-purified-polyclonal-ab-41202410484365.jpg)
![Immunocytochemistry SOX9 Antibody [Unconjugated]](https://images.novusbio.com/images2/SOX9_AF3075_Immunocytochemistry_15995.jpg)
![Western Blot SOX9 Antibody [Unconjugated]](https://images.novusbio.com/images2/SOX9_AF3075_Western_Blot_21580.jpg)
![Immunocytochemistry SOX9 Antibody [Unconjugated]](https://images.novusbio.com/images2/SOX9_AF3075_Immunocytochemistry_6490.jpg)
![Immunohistochemistry Desmin Antibody [Unconjugated]](https://images.novusbio.com/images2/Desmin_AF3844_Immunohistochemistry_10689.jpg)
![Immunohistochemistry Desmin Antibody [Unconjugated]](https://images.novusbio.com/images2/Desmin_AF3844_Immunohistochemistry_6808.jpg)
![Immunocytochemistry/ Immunofluorescence Desmin Antibody [Unconjugated]](https://images.novusbio.com/images/af3844_human-mouse-desmin-affinity-purified-polyclonal-ab-41202410331920.jpg)
![Immunohistochemistry CD34 Antibody [Unconjugated]](https://images.novusbio.com/images2/CD34_AF4117_Immunohistochemistry_6824.jpg)
![Simple Western Pax6 Antibody [Unconjugated]](https://images.novusbio.com/images2/Pax6_AF8150_Simple_Western_17126.jpg)
![Immunocytochemistry Pax6 Antibody [Unconjugated]](https://images.novusbio.com/images2/Pax6_AF8150_Immunocytochemistry_14427.jpg)
![Western Blot Pax6 Antibody [Unconjugated]](https://images.novusbio.com/images2/Pax6_AF8150_Western_Blot_14743.jpg)
![Western Blot c-Abl Antibody [Unconjugated]](https://images.novusbio.com/images2/c-Abl_AF5414_Western_Blot_5714.jpg)
![Simple Western c-Abl Antibody [Unconjugated]](https://images.novusbio.com/images2/cAbl_AF5414_Simple_Western_17046.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")