WRN Antibody (2F7) Summary
Description |
Quality control test: Antibody Reactive Against Recombinant Protein. |
Immunogen |
WRN (NP_000544, 1322 a.a. ~ 1432 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. NPPVNSDMSKISLIRMLAPENIDTYLIHMAIEILKHGPDSGLQPSCDVNKRRCFPGSEEICSSSKRSKEEVGINTETSSAERKRRLPVWFAKGSDTSKKLMDKTKRGGLFS |
Isotype |
IgG1 Kappa |
Clonality |
Monoclonal |
Host |
Mouse |
Gene |
WRN |
Purity |
IgG purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
|
Application Notes |
It has been used for ELISA and WB. |
Packaging, Storage & Formulations
Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer |
In 1x PBS, pH 7.4 |
Preservative |
No Preservative |
Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for WRN Antibody (2F7)
Background
This gene encodes a member of the RecQ subfamily and the DEAH (Asp-Glu-Ala-His) subfamily of DNA and RNA helicases. DNA helicases are involved in many aspects of DNA metabolism, including transcription, replication, recombination, and repair. This protein contains a nuclear localization signal in the C-terminus and shows a predominant nucleolar localization. It possesses an intrinsic 3' to 5' DNA helicase activity, and is also a 3' to 5' exonuclease. Based on interactions between this protein and Ku70/80 heterodimer in DNA end processing, this protein may be involved in the repair of double strand DNA breaks. Defects in this gene are the cause of Werner syndrome, an autosomal recessive disorder characterized by premature aging.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Bv, Fe, Hu, Rb
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Ch, Dr, Fi, Hu, Mar, Mu, Po, Pm, Rb, Rt, Ye, Ze
Applications: ChIP, ChIP, ELISA, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: ChIP, ICC/IF, IP, WB
Species: Ha, Hu, Mu, Rt
Applications: ChIP, IP, WB
Species: ChHa, Hu, Mu, Pm, Rt
Applications: ChIP, DB, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, KD, Simple Western, WB
Species: Hu, Pm, Mu, Rt
Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, KD, PAGE, Single-Cell Western, WB
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, Flow, ICC/IF, WB
Species: Ch, Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, KD, PLA, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, KO, WB
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, IP, WB
Species: Hu
Applications: ICC, IHC, Simple Western, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Publications for WRN Antibody (H00007486-M06) (0)
There are no publications for WRN Antibody (H00007486-M06).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for WRN Antibody (H00007486-M06) (0)
There are no reviews for WRN Antibody (H00007486-M06).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for WRN Antibody (H00007486-M06) (0)