WIPF1/WIP Antibody - Azide and BSA Free Summary
Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 400-500 of human WIPF1/WIP (NP_001070737.1). QLPSRSGVDSPRSGPRPPLPPDRPSAGAPPPPPPSTSIRNGFQDSPCEDEWESRFYFHPISDLPPPEPYVQTTKSYPSKLARNESRSGSNRRERGAPPLPP |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
WIPF1 |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunohistochemistry 1:100 - 1:200
- Immunohistochemistry-Paraffin
- Western Blot 1:500 - 1:2000
|
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles. |
Buffer |
PBS, 50% glycerol, pH7.3 |
Preservative |
0.01% Thimerosal |
Purity |
Affinity purified |
Alternate Names for WIPF1/WIP Antibody - Azide and BSA Free
Background
WIPF1 is involved in the organization of the actin cytoskeleton. The protein binds to a region of Wiskott-Aldrich syndrome protein that is frequently mutated in Wiskott-Aldrich syndrome, an X-linked recessive disorder. Impairment of the interaction between these WIPF1 and Wiskott-Aldrich syndrome protein may contribute to the disease. Two transcript variants encoding the same protein have been identified for this gene. WIPF1 binds to Wiskott-Aldrich syndrome protein, profilin and actin. It is involved with NCK1 and GRB2 in the recruitment and activation of N-WASP and may be involved in regulating the subcellular localization of N-WASP, resulting in the disassembly of stress fibers in filopodia formation.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, Simple Western, WB
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
Species: Mu
Applications: IHC, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, IP, WB
Species: Hu, Pm, Pm
Applications: CyTOF-ready, ELISA, Flow, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IP, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, Simple Western, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, IHC
⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov
Publications for WIPF1/WIP Antibody (NBP3-15508) (0)
There are no publications for WIPF1/WIP Antibody (NBP3-15508).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for WIPF1/WIP Antibody (NBP3-15508) (0)
There are no reviews for WIPF1/WIP Antibody (NBP3-15508).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for WIPF1/WIP Antibody (NBP3-15508) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional WIPF1/WIP Products
Research Areas for WIPF1/WIP Antibody (NBP3-15508)
Find related products by research area.
|
Blogs on WIPF1/WIP