![Western Blot: HIP-55 Antibody [NBP1-91988] - Analysis using Anti-DBNL antibody NBP1-91988 (A) shows similar pattern to independent antibody NBP1-91989 (B).](http://images.novusbio.com/fullsize/HIP-55-Antibody-Western-Blot-NBP1-91988-img0011.jpg "Western Blot: HIP-55 Antibody [NBP1-91988] - Analysis using Anti-DBNL antibody NBP1-91988 (A) shows similar pattern to independent antibody NBP1-91989 (B).")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: INWTGEGVNDVRKGACASHVSTMASFLKGAHVTINARAEEDVEPECIMEKVAKASGANYSFHKESGRFQDVGPQAPVGSVYQ |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | DBNL |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for HIP-55 Antibody (NBP1-91988)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | DBNL |
![Immunohistochemistry-Paraffin: HIP-55 Antibody [NBP1-91988] - Staining of human testis.](http://images.novusbio.com/fullsize/HIP-55-Antibody-Immunohistochemistry-Paraffin-NBP1-91988-img0013.jpg "Immunohistochemistry-Paraffin: HIP-55 Antibody [NBP1-91988] - Staining of human testis.")
![Western Blot: HIP-55 Antibody [NBP1-91988] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).](http://images.novusbio.com/fullsize/HIP-55-Antibody-Western-Blot-NBP1-91988-img0006.jpg "Western Blot: HIP-55 Antibody [NBP1-91988] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).")
![Immunohistochemistry-Paraffin: HIP-55 Antibody [NBP1-91988] - Staining of human liver shows low expression as expected.](http://images.novusbio.com/fullsize/HIP-55-Antibody-Immunohistochemistry-Paraffin-NBP1-91988-img0007.jpg "Immunohistochemistry-Paraffin: HIP-55 Antibody [NBP1-91988] - Staining of human liver shows low expression as expected.")
![Immunohistochemistry-Paraffin: HIP-55 Antibody [NBP1-91988] - Staining of human lymph node shows high expression.](http://images.novusbio.com/fullsize/HIP-55-Antibody-Immunohistochemistry-Paraffin-NBP1-91988-img0008.jpg "Immunohistochemistry-Paraffin: HIP-55 Antibody [NBP1-91988] - Staining of human lymph node shows high expression.")
![Immunohistochemistry-Paraffin: HIP-55 Antibody [NBP1-91988] - Staining in human lymph node and liver tissues using anti-DBNL antibody. Corresponding DBNL RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/HIP-55-Antibody-Immunohistochemistry-Paraffin-NBP1-91988-img0009.jpg "Immunohistochemistry-Paraffin: HIP-55 Antibody [NBP1-91988] - Staining in human lymph node and liver tissues using anti-DBNL antibody. Corresponding DBNL RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: HIP-55 Antibody [NBP1-91988] - Staining of human cerebral cortex, liver, lymph node and testis using Anti-DBNL antibody NBP1-91988 (A) shows similar protein distribution across tissues to independent antibody NBP1-91989 (B).](http://images.novusbio.com/fullsize/HIP-55-Antibody-Immunohistochemistry-Paraffin-NBP1-91988-img0010.jpg "Immunohistochemistry-Paraffin: HIP-55 Antibody [NBP1-91988] - Staining of human cerebral cortex, liver, lymph node and testis using Anti-DBNL antibody NBP1-91988 (A) shows similar protein distribution across tissues to independent antibody NBP1-91989 (B).")
![Immunohistochemistry-Paraffin: HIP-55 Antibody [NBP1-91988] - Staining of human cerebral cortex.](http://images.novusbio.com/fullsize/HIP-55-Antibody-Immunohistochemistry-Paraffin-NBP1-91988-img0012.jpg "Immunohistochemistry-Paraffin: HIP-55 Antibody [NBP1-91988] - Staining of human cerebral cortex.")
![Western Blot ALS Antibody [Unconjugated]](https://images.novusbio.com/images2/ALS_AF1436_Western_Blot_17079.jpg)
![Immunohistochemistry Adrenomedullin/ADM Antibody [Unconjugated]](https://images.novusbio.com/images2/Adrenomedullin_AF6108_Immunohistochemistry_9966.jpg)
![Western Blot Src [p Tyr419] Antibody [Unconjugated]](https://images.novusbio.com/images2/Src_AF2685_Western_Blot_5209.jpg)
![Simple Western Src [p Tyr419] Antibody [Unconjugated]](https://images.novusbio.com/images2/16327.jpg)
![Immunohistochemistry Src [p Tyr419] Antibody [Unconjugated]](https://images.novusbio.com/images2/Src_AF2685_Immunohistochemistry_7158.jpg)
![Western Blot Cathepsin L Antibody [Unconjugated]](https://images.novusbio.com/images2/Cathepsin_L_AF952_Western_Blot_20998.jpg)
![Immunohistochemistry Cathepsin L Antibody [Unconjugated]](https://images.novusbio.com/images2/Cathepsin_L_AF952_Immunohistochemistry_17794.jpg)
![Western Blot Cathepsin L Antibody [Unconjugated]](https://images.novusbio.com/images/af952_human-cathepsin-l-affinity-purified-polyclonal-ab-8220249511428.jpg)
![Western Blot Angiopoietin-like Protein 2/ANGPTL2 Antibody [Unconjugated]](https://images.novusbio.com/images2/Angiopoietinlike_Protein_2_AF1444_Western_Blot_19840.jpg)
![Simple Western Gelsolin/GSN Antibody (893205) [Unconjugated]](https://images.novusbio.com/images2/Gelsolin_MAB8170_Simple_Western_17259.jpg)
![Western Blot Gelsolin/GSN Antibody (893205) [Unconjugated]](https://images.novusbio.com/images2/Gelsolin_MAB8170_Western_Blot_14481.jpg)
![Immunohistochemistry Gelsolin/GSN Antibody (893205) [Unconjugated]](https://images.novusbio.com/images2/Gelsolin_MAB8170_Immunohistochemistry_14553.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")