Home » VDR/NR1I1/Vitamin D Receptor » VDR/NR1I1/Vitamin D Receptor Proteins » VDR/NR1I1/Vitamin D Receptor Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

VDR/NR1I1/Vitamin D Receptor Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for VDR/NR1I1/Vitamin D Receptor Recombinant Protein Antigen (NBP2-55786PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

VDR/NR1I1/Vitamin D Receptor Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human VDR/NR1I1/Vitamin D Receptor.

Source: E. coli

Amino Acid Sequence: DAHHKTYDPTYSDFCQFRPPVRVNDGGGSHPSRPNSRHTPSFSGDSSSSCSDHCITSSDMMDSSSFSNLDLSEEDSDDP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
VDR
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55786.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for VDR/NR1I1/Vitamin D Receptor Recombinant Protein Antigen

  • NR1I1
  • NR1I1Nuclear receptor subfamily 1 group I member 11,25-dihydroxyvitamin D3 receptor
  • VDR
  • vitamin D1,25- dihydroxyvitamin D3 receptor
  • vitamin D3 receptor

Background

Vitamin D Receptor encodes the nuclear hormone receptor for vitamin D3. This receptor also functions as a receptor for the secondary bile acid lithocholic acid. The receptor belongs to the family of trans-acting transcriptional regulatory factors and shows sequence similarity to the steroid and thyroid hormone receptors. Downstream targets of this nuclear hormone receptor are principally involved in mineral metabolism though the receptor regulates a variety of other metabolic pathways, such as those involved in the immune response and cancer. Mutations in this gene are associated with type II vitamin D-resistant rickets. A single nucleotide polymorphism in the initiation codon results in an alternate translation start site three codons downstream. Alternative splicing results in multiple transcript variants encoding the same protein.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

PTH Antibody
(918462) [Unconjugate
MAB7665
Immunohistochemistry PTH Antibody (918462) [Unconjugated]
Western Blot PTH Antibody (918462) [Unconjugated]
Species: Hu
Applications: IHC, WB
CYP24A1 Antibody
NBP1-85495
Immunohistochemistry-Paraffin CYP24A1 Antibody
Immunohistochemistry-Paraffin CYP24A1 Antibody
Immunohistochemistry-Paraffin CYP24A1 Antibody
(2 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Osteocalcin
Antibody (190125)
MAB1419
Intracellular Staining by Flow Cytometry Osteocalcin Antibody (190125)
Intracellular Staining by Flow Cytometry Osteocalcin Antibody (190125)
Immunocytochemistry Osteocalcin Antibody (190125)
(3 Reviews)
(56 Publications)
Species: Hu, Rt
Applications: CyTOF-ready, ICC, IHC, ICFlow
Dystrophin Antibody
NBP1-89953
Immunohistochemistry-Paraffin Dystrophin Antibody
Immunohistochemistry-Paraffin Dystrophin Antibody
Immunohistochemistry-Paraffin Dystrophin Antibody
(4 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Bestrophin 1
Antibody (E6-6) - BSA
NB300-164
Knockout Validated Bestrophin 1 Antibody (E6-6) - BSA Free
Immunohistochemistry-Paraffin Bestrophin 1 Antibody (E6-6) - BSA Free
Immunohistochemistry-Paraffin Bestrophin 1 Antibody (E6-6) - BSA Free
(1 Review)
(49 Publications)
Species: Ca, Hu, Mu, Po, Pm, Rt(-)
Applications: Dual ISH-IHC, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KO, PLA, WB
PTRH1 Antibody
NBP1-86713
Immunohistochemistry-Paraffin PTRH1 Antibody
Species: Hu
Applications: IHC, IHC-P
Osteopontin/OPN
Antibody [Unconjugate
AF808
Immunocytochemistry Osteopontin/OPN Antibody [Unconjugated]
Neutralization Osteopontin/OPN Antibody [Unconjugated]
Immunohistochemistry Osteopontin/OPN Antibody [Unconjugated]
(2 Reviews)
(207 Publications)
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, IHC, Neut, WB
p21/CIP1/CDKN1A
Antibody (WA-1)
NBP2-29463
Immunohistochemistry-Paraffin p21/CIP1/CDKN1A Antibody (WA-1)
(24 Publications)
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Recombinant Human
CYP27B1 GST (N-Term) ...
H00001594-Q01
Other Recombinant Human CYP27B1 GST (N-Term) Protein
Species: Hu
Applications: ELISA, AP, PA, WB
ER alpha/NR3A1
Antibody (33)
NB300-560
Western Blot ER alpha/NR3A1 Antibody (33)
Immunohistochemistry-Frozen ER alpha/NR3A1 Antibody (33)
Immunohistochemistry-Paraffin ER alpha/NR3A1 Antibody (33)
(1 Review)
(11 Publications)
Species: Av, Bv, Ma, Hu, Mu, Pm, Rt
Applications: IF, IHC, IHC-Fr, IHC-P, WB
PXR/NR1I2 Antibody
(H4417) [Unconjugated ...
PP-H4417-00
PXR/NR1I2 Antibody (H4417) [Unconjugated]
(2 Publications)
Species: Hu
Applications: DirELISA, IP, WB
Calcium-sensing
R/CaSR Antibody (5C10 ...
NB120-19347
Western Blot Calcium-sensing R/CaSR Antibody (5C10, ADD) - BSA Free
Immunocytochemistry/ Immunofluorescence Calcium-sensing R/CaSR Antibody (5C10, ADD) - BSA Free
Immunocytochemistry/ Immunofluorescence Calcium-sensing R/CaSR Antibody (5C10, ADD) - BSA Free
(1 Review)
(21 Publications)
Species: Bv, Hu, Mu, Po, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(817 Publications)
Species: Hu
Applications: BA
RAR alpha/NR1B1
Antibody (763)
NB200-322
Western Blot RAR alpha/NR1B1 Antibody (763)
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, WB
Androgen R/NR3C4
[p Ser213, p Ser210] ...
NB100-56603
Western Blot Androgen R/NR3C4 [p Ser213, p Ser210] Antibody (156C135.2) - BSA Free
(14 Publications)
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
IL-6 [HRP]
M6000B
N/A IL-6 [HRP]
N/A IL-6 [HRP]
N/A IL-6 [HRP]
(663 Publications)
Species: Mu
Applications: ELISA
CAR/NR1I3 Antibody
(N4111) [Unconjugated ...
PP-N4111-00
CAR/NR1I3 Antibody (N4111) [Unconjugated]
(8 Publications)
Species: Hu
Applications: IHC, IP, WB
TRAP220/MED1
Antibody
AF5520
Western Blot TRAP220/MED1 Antibody
(1 Review)
(1 Publication)
Species: Hu, Mu
Applications: WB
Calbindin D-28K
Antibody
NBP2-50028
Western Blot Calbindin D-28K Antibody
Immunocytochemistry/ Immunofluorescence Calbindin D-28K Antibody
Western Blot Calbindin D-28K Antibody
(1 Review)
(13 Publications)
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC-FrFl, IHC, IHC-P, WB
VDR/NR1I1/Vitamin
D Receptor Recombinan ...
NBP2-55786PEP
VDR/NR1I1/Vitamin D Receptor Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for VDR/NR1I1/Vitamin D Receptor Recombinant Protein Antigen (NBP2-55786PEP) (0)

There are no publications for VDR/NR1I1/Vitamin D Receptor Recombinant Protein Antigen (NBP2-55786PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for VDR/NR1I1/Vitamin D Receptor Recombinant Protein Antigen (NBP2-55786PEP) (0)

There are no reviews for VDR/NR1I1/Vitamin D Receptor Recombinant Protein Antigen (NBP2-55786PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for VDR/NR1I1/Vitamin D Receptor Recombinant Protein Antigen (NBP2-55786PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional VDR/NR1I1/Vitamin D Receptor Products

Research Areas for VDR/NR1I1/Vitamin D Receptor Recombinant Protein Antigen (NBP2-55786PEP)

Find related products by research area.

Blogs on VDR/NR1I1/Vitamin D Receptor

There are no specific blogs for VDR/NR1I1/Vitamin D Receptor, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our VDR/NR1I1/Vitamin D Receptor Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol VDR