![Western Blot: UTP6 Antibody [NBP1-88468] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2, using anti-UTP6 antibody. Remaining relative intensity is presented.](http://images.novusbio.com/fullsize/UTP6-Antibody-Western-Blot-NBP1-88468-img0013.jpg "Western Blot: UTP6 Antibody [NBP1-88468] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2, using anti-UTP6 antibody. Remaining relative intensity is presented.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC, KD |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: ARQLFLRALRFHPECPKLYKEYFRMELMHAEKLRKEKEEFEKASMDVENPDYSEEILKGELAWIIYKNSVSIIKGAEFHVSLLSIAQLFDFAKDLQKEIYDDLQALHTDDPLTWDYVARRELEIESQTEEQPTTKQAKAV |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | UTP6 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | UTP6 |
![Immunocytochemistry/Immunofluorescence: UTP6 Antibody [NBP1-88468] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoli.](http://images.novusbio.com/fullsize/UTP6-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-88468-img0008.jpg "Immunocytochemistry/Immunofluorescence: UTP6 Antibody [NBP1-88468] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoli.")
![Immunohistochemistry-Paraffin: UTP6 Antibody [NBP1-88468] - Staining of human tonsil shows strong positivity in nucleoli in lymphoid cells.](http://images.novusbio.com/fullsize/UTP6-Antibody-Immunohistochemistry-Paraffin-NBP1-88468-img0012.jpg "Immunohistochemistry-Paraffin: UTP6 Antibody [NBP1-88468] - Staining of human tonsil shows strong positivity in nucleoli in lymphoid cells.")
![Western Blot: UTP6 Antibody [NBP1-88468] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).](http://images.novusbio.com/fullsize/UTP6-Antibody-Western-Blot-NBP1-88468-img0006.jpg "Western Blot: UTP6 Antibody [NBP1-88468] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).")
![Immunohistochemistry-Paraffin: UTP6 Antibody [NBP1-88468] - Staining of human liver shows strong to strong positivity in nucleoli in hepatocytes.](http://images.novusbio.com/fullsize/UTP6-Antibody-Immunohistochemistry-Paraffin-NBP1-88468-img0009.jpg "Immunohistochemistry-Paraffin: UTP6 Antibody [NBP1-88468] - Staining of human liver shows strong to strong positivity in nucleoli in hepatocytes.")
![Immunohistochemistry-Paraffin: UTP6 Antibody [NBP1-88468] - Staining of human skin shows strong positivity in nucleoli in epidermal cells.](http://images.novusbio.com/fullsize/UTP6-Antibody-Immunohistochemistry-Paraffin-NBP1-88468-img0010.jpg "Immunohistochemistry-Paraffin: UTP6 Antibody [NBP1-88468] - Staining of human skin shows strong positivity in nucleoli in epidermal cells.")
![Immunohistochemistry-Paraffin: UTP6 Antibody [NBP1-88468] - Staining of human testis shows strong positivity in nucleoli.](http://images.novusbio.com/fullsize/UTP6-Antibody-Immunohistochemistry-Paraffin-NBP1-88468-img0011.jpg "Immunohistochemistry-Paraffin: UTP6 Antibody [NBP1-88468] - Staining of human testis shows strong positivity in nucleoli.")
![Immunoprecipitation SUZ12 Antibody (448909) [Unconjugated]](https://images.novusbio.com/images2/SUZ12_MAB4184_Immunoprecipitation_15440.jpg)
![Western Blot SUZ12 Antibody (448909) [Unconjugated]](https://images.novusbio.com/images2/SUZ12_MAB4184_Western_Blot_12094.jpg)
![Immunocytochemistry SUZ12 Antibody (448909) [Unconjugated]](https://images.novusbio.com/images2/SUZ12_MAB4184_Immunocytochemistry__Immunofluorescence_20494.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")