![Western Blot: USP39 Antibody (1S9R9) [NBP3-16119] - Western blot analysis of extracts of Mouse liver, using USP39 antibody (NBP3-16119) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.](http://images.novusbio.com/fullsize/USP39-Antibody-1S9R9-Western-Blot-NBP3-16119-img0008.jpg "Western Blot: USP39 Antibody (1S9R9) [NBP3-16119] - Western blot analysis of extracts of Mouse liver, using USP39 antibody (NBP3-16119) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clone | 1S9R9 |
| Clonality | Monoclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Additional Information | Recombinant Monoclonal Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 466-565 of Human USP39 (Q53GS9). KNPTIVNFPITNVDLREYLSEEVQAVHKNTTYDLIANIVHDGKPSEGSYRIHVLHHGTGKWYELQDLQVTDILPQMITLSEAYIQIWKRRDNDETNQQGA |
| Isotype | IgG |
| Clonality | Monoclonal |
| Host | Rabbit |
| Gene | USP39 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
![Simple Western alpha-Fetoprotein/AFP Antibody (189502) [Unconjugated]](https://images.novusbio.com/images2/16253.jpg)
![Knockout Validated alpha-Fetoprotein/AFP Antibody (189502) [Unconjugated]](https://images.novusbio.com/images2/alphaFetoprotein_MAB1368_Knockout_Validated_21503.jpg)
![Knockout Validated alpha-Fetoprotein/AFP Antibody (189502) [Unconjugated]](https://images.novusbio.com/images2/alphaFetoprotein_MAB1368_Knockout_Validated_22402.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for USP39 Antibody (NBP3-16119)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | USP39 |
![Immunocytochemistry/Immunofluorescence: USP39 Antibody (1S9R9) [NBP3-16119] - Immunofluorescence analysis of U2OS cells using USP39 Rabbit mAb (NBP3-16119) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/USP39-Antibody-1S9R9-Immunocytochemistry-Immunofluorescence-NBP3-16119-img0007.jpg "Immunocytochemistry/Immunofluorescence: USP39 Antibody (1S9R9) [NBP3-16119] - Immunofluorescence analysis of U2OS cells using USP39 Rabbit mAb (NBP3-16119) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.")
![Immunocytochemistry/Immunofluorescence: USP39 Antibody (1S9R9) [NBP3-16119] - Immunofluorescence analysis of NIH/3T3 cells using USP39 Rabbit mAb (NBP3-16119) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/USP39-Antibody-1S9R9-Immunocytochemistry-Immunofluorescence-NBP3-16119-img0005.jpg "Immunocytochemistry/Immunofluorescence: USP39 Antibody (1S9R9) [NBP3-16119] - Immunofluorescence analysis of NIH/3T3 cells using USP39 Rabbit mAb (NBP3-16119) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.")
![Immunocytochemistry/Immunofluorescence: USP39 Antibody (1S9R9) [NBP3-16119] - Immunofluorescence analysis of PC-12 cells using USP39 Rabbit mAb (NBP3-16119) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/USP39-Antibody-1S9R9-Immunocytochemistry-Immunofluorescence-NBP3-16119-img0006.jpg "Immunocytochemistry/Immunofluorescence: USP39 Antibody (1S9R9) [NBP3-16119] - Immunofluorescence analysis of PC-12 cells using USP39 Rabbit mAb (NBP3-16119) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.")
![Immunohistochemistry: USP39 Antibody (1S9R9) [NBP3-16119] - Immunohistochemistry analysis of USP39 in paraffin-embedded rat spleen tissue using USP39 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-16119_rabbit-usp39-mab-1s9r9-72202512443334.jpg "Immunohistochemistry: USP39 Antibody (1S9R9) [NBP3-16119] - Immunohistochemistry analysis of USP39 in paraffin-embedded rat spleen tissue using USP39 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.")
![Immunohistochemistry: USP39 Antibody (1S9R9) [NBP3-16119] - Immunohistochemistry analysis of USP39 in paraffin-embedded human thyroid cancer tissue using USP39 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-16119_rabbit-usp39-mab-1s9r9-72202512435392.jpg "Immunohistochemistry: USP39 Antibody (1S9R9) [NBP3-16119] - Immunohistochemistry analysis of USP39 in paraffin-embedded human thyroid cancer tissue using USP39 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.")
![Immunohistochemistry: USP39 Antibody (1S9R9) [NBP3-16119] - Immunohistochemistry analysis of USP39 in paraffin-embedded mouse testis tissue using USP39 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-16119_rabbit-usp39-mab-1s9r9-7220251243208.jpg "Immunohistochemistry: USP39 Antibody (1S9R9) [NBP3-16119] - Immunohistochemistry analysis of USP39 in paraffin-embedded mouse testis tissue using USP39 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.")
![Immunohistochemistry: USP39 Antibody (1S9R9) [NBP3-16119] - Immunohistochemistry analysis of USP39 in paraffin-embedded mouse lung tissue using USP39 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-16119_rabbit-usp39-mab-1s9r9-7220251245351.jpg "Immunohistochemistry: USP39 Antibody (1S9R9) [NBP3-16119] - Immunohistochemistry analysis of USP39 in paraffin-embedded mouse lung tissue using USP39 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.")
![Immunohistochemistry: USP39 Antibody (1S9R9) [NBP3-16119] - Immunohistochemistry analysis of USP39 in paraffin-embedded mouse brain tissue using USP39 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-16119_rabbit-usp39-mab-1s9r9-72202512432087.jpg "Immunohistochemistry: USP39 Antibody (1S9R9) [NBP3-16119] - Immunohistochemistry analysis of USP39 in paraffin-embedded mouse brain tissue using USP39 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.")
![Immunohistochemistry: USP39 Antibody (1S9R9) [NBP3-16119] - Immunohistochemistry analysis of USP39 in paraffin-embedded mouse intestin tissue using USP39 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-16119_rabbit-usp39-mab-1s9r9-72202512432056.jpg "Immunohistochemistry: USP39 Antibody (1S9R9) [NBP3-16119] - Immunohistochemistry analysis of USP39 in paraffin-embedded mouse intestin tissue using USP39 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.")
![Immunohistochemistry: USP39 Antibody (1S9R9) [NBP3-16119] - Immunohistochemistry analysis of USP39 in paraffin-embedded human spleen tissue using USP39 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-16119_rabbit-usp39-mab-1s9r9-72202512443345.jpg "Immunohistochemistry: USP39 Antibody (1S9R9) [NBP3-16119] - Immunohistochemistry analysis of USP39 in paraffin-embedded human spleen tissue using USP39 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.")
![Immunohistochemistry: USP39 Antibody (1S9R9) [NBP3-16119] - Immunohistochemistry analysis of USP39 in paraffin-embedded rat brain tissue using USP39 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-16119_rabbit-usp39-mab-1s9r9-7220251245316.jpg "Immunohistochemistry: USP39 Antibody (1S9R9) [NBP3-16119] - Immunohistochemistry analysis of USP39 in paraffin-embedded rat brain tissue using USP39 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.")
![Immunohistochemistry: USP39 Antibody (1S9R9) [NBP3-16119] - Immunohistochemistry analysis of USP39 in paraffin-embedded mouse kidney tissue using USP39 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-16119_rabbit-usp39-mab-1s9r9-7220251245375.jpg "Immunohistochemistry: USP39 Antibody (1S9R9) [NBP3-16119] - Immunohistochemistry analysis of USP39 in paraffin-embedded mouse kidney tissue using USP39 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.")
![Immunohistochemistry: USP39 Antibody (1S9R9) [NBP3-16119] - Immunohistochemistry analysis of USP39 in paraffin-embedded human colon carcinoma tissue using USP39 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-16119_rabbit-usp39-mab-1s9r9-7220251245324.jpg "Immunohistochemistry: USP39 Antibody (1S9R9) [NBP3-16119] - Immunohistochemistry analysis of USP39 in paraffin-embedded human colon carcinoma tissue using USP39 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.")
![Simple Western c-Rel Antibody [Unconjugated]](https://images.novusbio.com/images2/cRel_AF2699_Simple_Western_16940.jpg)
![Western Blot c-Rel Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af2699_human-mouse-c-rel-affinity-purified-polyclonal-ab-western-blot-2102024121216..jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")