![Western Blot: USH1C Antibody [NBP1-89190] - Analysis in human cell lines Caco-2 and PC-3 using anti-USH1C antibody. Corresponding USH1C RNA-seq data are presented for the same cell lines. Loading control: anti-HSP90B1.](http://images.novusbio.com/fullsize/USH1C-Antibody-Western-Blot-NBP1-89190-img0016.jpg "Western Blot: USH1C Antibody [NBP1-89190] - Analysis in human cell lines Caco-2 and PC-3 using anti-USH1C antibody. Corresponding USH1C RNA-seq data are presented for the same cell lines. Loading control: anti-HSP90B1.")
| Reactivity | Hu, MuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: IVEEEEKFKKQWEEDWGSKEQLLLPKTITAEVHPVPLRKPKYDQGVEPELEPADDLDGGTEEQGEQDFRKYEEGFDPYSM |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | USH1C |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publication using NBP1-89190 | Applications | Species |
|---|---|---|
| McConnell RE, Benesh AE, Mao S et al. Proteomic analysis of the enterocyte brush border. Am J Physiol Gastrointest Liver Physiol 2011-05-01 [PMID: 21330445] |
Secondary Antibodies |
Isotype Controls |
Research Areas for USH1C Antibody (NBP1-89190)Find related products by research area.
|
|
Auditory Infographic: Can you hear me now? The auditory process involves several structures of the ear to convert sound waves into information that is processed by our brain. Learn more about the auditory process in our infographic below. Novus Biologicals offers reagents mentioned in the inf... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | USH1C |
![Immunocytochemistry/Immunofluorescence: USH1C Antibody [NBP1-89190] - Staining of human cell line CACO-2 shows localization to cytosol. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/USH1C-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-89190-img0011.jpg "Immunocytochemistry/Immunofluorescence: USH1C Antibody [NBP1-89190] - Staining of human cell line CACO-2 shows localization to cytosol. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: USH1C Antibody [NBP1-89190] - Staining of human duodenum shows strong membranous and cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/USH1C-Antibody-Immunohistochemistry-Paraffin-NBP1-89190-img0014.jpg "Immunohistochemistry-Paraffin: USH1C Antibody [NBP1-89190] - Staining of human duodenum shows strong membranous and cytoplasmic positivity in glandular cells.")
![Western Blot: USH1C Antibody [NBP1-89190] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.](http://images.novusbio.com/fullsize/USH1C-Antibody-Western-Blot-NBP1-89190-img0008.jpg "Western Blot: USH1C Antibody [NBP1-89190] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.")
![Immunocytochemistry Protocadherin-15 Antibody [Unconjugated]](https://images.novusbio.com/images2/Protocadherin-15_AF6729_Immunocytochemistry_10774.jpg)
![Western Blot Protocadherin-15 Antibody [Unconjugated]](https://images.novusbio.com/images2/Protocadherin-15_AF6729_Western_Blot_11962.jpg)
![Immunohistochemistry Protocadherin-15 Antibody [Unconjugated]](https://images.novusbio.com/images2/Protocadherin15_AF6729_Immunohistochemistry_19790.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")