![Western Blot: Uridine Phosphorylase 1/UPP1 Antibody (2F5) [H00007378-M01] - Western Blot detection against immunogen (35.86 KDa)](http://images.novusbio.com/fullsize/Uridine-Phosphorylase-1-UPP1-Antibody-2F5-Western-Blot-H00007378-M01-img0005.jpg "Western Blot: Uridine Phosphorylase 1/UPP1 Antibody (2F5) [H00007378-M01] - Western Blot detection against immunogen (35.86 KDa)")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA, IHC |
| Clone | 2F5 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Description | Quality control test: Antibody Reactive Against Recombinant Protein. |
| Immunogen | UPP1 (NP_003355, 1 a.a. ~ 92 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAATGANAEKAESHNDCPVRLLNPNIAKMKEDILYHFNLTTSRHNFPALFGDVKFVCVGGSPSRMKAFIRCVGAELGLDCPGRDYPNICAGT |
| Specificity | UPP1 - uridine phosphorylase 1 (2F5) |
| Isotype | IgG2a Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | UPP1 |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
| Theoretical MW | 34 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for Uridine Phosphorylase 1/UPP1 Antibody (H00007378-M01)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: Uridine Phosphorylase 1/UPP1 Antibody (2F5) [H00007378-M01] - Analysis of monoclonal antibody to UPP1 on formalin-fixed paraffin-embedded human kidney. Antibody concentration 3 ug/ml.](http://images.novusbio.com/fullsize/Uridine-Phosphorylase-1-UPP1-Antibody-2F5-Immunohistochemistry-Paraffin-H00007378-M01-img0002.jpg "Immunohistochemistry-Paraffin: Uridine Phosphorylase 1/UPP1 Antibody (2F5) [H00007378-M01] - Analysis of monoclonal antibody to UPP1 on formalin-fixed paraffin-embedded human kidney. Antibody concentration 3 ug/ml.")
![ELISA: Uridine Phosphorylase 1/UPP1 Antibody (2F5) [H00007378-M01] - Detection limit for recombinant GST tagged UPP1 is 0.3 ng/ml as a capture antibody.](http://images.novusbio.com/fullsize/Uridine-Phosphorylase-1-UPP1-Antibody-2F5-ELISA-H00007378-M01-img0004.jpg "ELISA: Uridine Phosphorylase 1/UPP1 Antibody (2F5) [H00007378-M01] - Detection limit for recombinant GST tagged UPP1 is 0.3 ng/ml as a capture antibody.")
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Western Blot Butyrylcholinesterase/BCHE Antibody [Unconjugated]](https://images.novusbio.com/images2/Butyrylcholinesterase_AF9024_Western_Blot_19121.jpg)
![Immunohistochemistry Butyrylcholinesterase/BCHE Antibody [Unconjugated]](https://images.novusbio.com/images2/Butyrylcholinesterase_AF9024_Immunohistochemistry_19158.jpg)
