![Western Blot: UBE2J2/UBC6 Antibody [NBP1-59760] - TMEM129 and Ube2J2 are required for US11-induced FcRn ubiquitination, a, b TMEM129 and Ube2J2 is required for US11-induced FcRn ubiquitination. HeLaFcRn+US11 cells were transfected with 20 nM TMEM129, Ube2J1, or Ube2J2 siRNA oligomers for 48 hr or empty vector. Cells were subsequently treated with 50 uM MG132 for 4 hr and then lysed. All immunoprecipitates or cell lysates (20 ug) as internal controls were subject to western blotting with corresponding Abs as indicated. Image collected and cropped by CiteAb from the following publication (www.nature.com/articles/s41467-019-10865-y) licensed under a CC-BY license.](http://images.novusbio.com/fullsize/UBE2J2-UBC6-Antibody-Knockdown-Validated-NBP1-59760-img0004.jpg "Western Blot: UBE2J2/UBC6 Antibody [NBP1-59760] - TMEM129 and Ube2J2 are required for US11-induced FcRn ubiquitination, a, b TMEM129 and Ube2J2 is required for US11-induced FcRn ubiquitination. HeLaFcRn+US11 cells were transfected with 20 nM TMEM129, Ube2J1, or Ube2J2 siRNA oligomers for 48 hr or empty vector. Cells were subsequently treated with 50 uM MG132 for 4 hr and then lysed. All immunoprecipitates or cell lysates (20 ug) as internal controls were subject to western blotting with corresponding Abs as indicated. Image collected and cropped by CiteAb from the following publication (www.nature.com/articles/s41467-019-10865-y) licensed under a CC-BY license.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC, KD |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Concentration | 1 mg/ml |
| Description | The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution. |
| Immunogen | Synthetic peptides corresponding to UBE2J2(ubiquitin-conjugating enzyme E2, J2 (UBC6 homolog, yeast)) The peptide sequence was selected from the C terminal of UBE2J2. Peptide sequence GIQLLNGHAPGAVPNLAGLQQANRHHGLLGGALANLFVIVGFAAFAYTVK. The peptide sequence for this immunogen was taken from within the described region. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | UBE2J2 |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Concentration | 1 mg/ml |
| Purity | Protein A purified |
| Publication using NBP1-59760 | Applications | Species |
|---|---|---|
| Liu X, Palaniyandi S, Zhu I et al. Human cytomegalovirus evades antibody-mediated immunity through endoplasmic reticulum-associated degradation of the FcRn receptor Nat Commun 2019-07-09 [PMID: 31289263] (WB, KD, Human) | WB, KD | Human |
Secondary Antibodies |
Isotype Controls |
Research Areas for UBE2J2/UBC6 Antibody (NBP1-59760)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | UBE2J2 |
![Western Blot: UBE2J2/UBC6 Antibody [NBP1-59760] - Titration: 1.25ug/ml Positive Control: HepG2 cell lysate.](http://images.novusbio.com/fullsize/UBE2J2-UBC6-Antibody-Western-Blot-NBP1-59760-img0003.jpg "Western Blot: UBE2J2/UBC6 Antibody [NBP1-59760] - Titration: 1.25ug/ml Positive Control: HepG2 cell lysate.")
![Immunohistochemistry-Paraffin: UBE2J2/UBC6 Antibody [NBP1-59760] - Human Intestine Tissue, antibody concentration 4-8ug/ml. Cells with positive label: Epithelial cells of intestinal villus (indicated with arrows) 400X magnification.](http://images.novusbio.com/fullsize/UBE2J2-UBC6-Antibody-Immunohistochemistry-Paraffin-NBP1-59760-img0002.jpg "Immunohistochemistry-Paraffin: UBE2J2/UBC6 Antibody [NBP1-59760] - Human Intestine Tissue, antibody concentration 4-8ug/ml. Cells with positive label: Epithelial cells of intestinal villus (indicated with arrows) 400X magnification.")
![Western Blot: UBE2J2/UBC6 Antibody [NBP1-59760] - TMEM129 & Ube2J2 are required for US11-induced FcRn ubiquitination, a, b TMEM129 & Ube2J2 is required for US11-induced FcRn ubiquitination. HeLaFcRn+US11 cells were transfected with 20 nM TMEM129, Ube2J1, or Ube2J2 siRNA oligomers for 48 h or empty vector. Cells were subsequently treated with 50 μM MG132 for 4 h & then lysed. All immunoprecipitates or cell lysates (20 μg) as internal controls were subject to western blotting with corresponding Abs as indicated. c, d HeLaUS11+FcRn cells were transfected with 20 nM Ube2J1 (c, top) & Ube2J2 (c, bottom) siRNA oligomers for 48 h. Cells were then treated with CHX (100 μg/ml) & chased for the indicated time. The cells were lysed after CHX treatment & cell lysates (20 μg) were subject to western blotting with Abs as indicated. The level of remaining FcRn (d) in Ube2j1 siRNA-treated cells (black) or Ube2j2 siRNA-treated cells (red) was quantified as the percentage of the beta -tubulin level at different time points. The percentage of time point 0 (min) is assigned a value of 100% & the values from other time points are normalized to this value. Error bars represented mean ± SEM of three independent repeats Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/31289263), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp1-59760_rabbit-polyclonal-ube2j2-ubc6-antibody-31020241616075.jpg "Western Blot: UBE2J2/UBC6 Antibody [NBP1-59760] - TMEM129 & Ube2J2 are required for US11-induced FcRn ubiquitination, a, b TMEM129 & Ube2J2 is required for US11-induced FcRn ubiquitination. HeLaFcRn+US11 cells were transfected with 20 nM TMEM129, Ube2J1, or Ube2J2 siRNA oligomers for 48 h or empty vector. Cells were subsequently treated with 50 μM MG132 for 4 h & then lysed. All immunoprecipitates or cell lysates (20 μg) as internal controls were subject to western blotting with corresponding Abs as indicated. c, d HeLaUS11+FcRn cells were transfected with 20 nM Ube2J1 (c, top) & Ube2J2 (c, bottom) siRNA oligomers for 48 h. Cells were then treated with CHX (100 μg/ml) & chased for the indicated time. The cells were lysed after CHX treatment & cell lysates (20 μg) were subject to western blotting with Abs as indicated. The level of remaining FcRn (d) in Ube2j1 siRNA-treated cells (black) or Ube2j2 siRNA-treated cells (red) was quantified as the percentage of the beta -tubulin level at different time points. The percentage of time point 0 (min) is assigned a value of 100% & the values from other time points are normalized to this value. Error bars represented mean ± SEM of three independent repeats Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/31289263), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![UbcH7/UBE2L3 [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "UbcH7/UBE2L3 [Unconjugated]")
![Immunohistochemistry CFTR Antibody (24-1) [Unconjugated] - C-terminus](https://images.novusbio.com/images2/CFTR_MAB25031_Immunohistochemistry_6973.jpg)
![Immunohistochemistry CFTR Antibody (24-1) [Unconjugated] - C-terminus](https://images.novusbio.com/images2/CFTR_MAB25031_Immunohistochemistry_9671.jpg)
![Immunoprecipitation CFTR Antibody (24-1) [Unconjugated] - C-terminus](https://images.novusbio.com/images/mab25031_human-cftr-c-terminus-mab-clone-24-1-41202412513815.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")