![Western Blot: TULP1 Antibody [NBP2-84319] - WB Suggested Anti-TULP1 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:62500. Positive Control: Human Small Intestine](http://images.novusbio.com/fullsize/TULP1-Antibody-Western-Blot-NBP2-84319-img0001.jpg "Western Blot: TULP1 Antibody [NBP2-84319] - WB Suggested Anti-TULP1 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:62500. Positive Control: Human Small Intestine")
| Reactivity | HuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Concentration | 0.5 mg/ml |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human TULP1. Peptide sequence: EEEEAATVIKKSNQKGKAKGKGKKKAKEERAPSPPVEVDEPREFVLRPAP The peptide sequence for this immunogen was taken from within the described region. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | TULP1 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Concentration | 0.5 mg/ml |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for TULP1 Antibody (NBP2-84319)Find related products by research area.
|
|
Can Tubby Make You Tubby? The TUB gene, which encodes for the protein Tubby, is evolutionarily conserved in human, chimpanzee, dog, cow, mouse, chicken, zebrafish, fruit fly, mosquito, C. elegans, and rice. The gene derives its name from its role in metabolism; mice with a m... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | TULP1 |
![Immunocytochemistry/ Immunofluorescence PNR/NR2E3 Antibody (H7223) [Unconjugated]](https://images.novusbio.com/images/pp-h7223-00_human-pnr-nr2e3-mab-clone-h7223-41202412514869.jpg)
![Immunocytochemistry/ Immunofluorescence PNR/NR2E3 Antibody (H7223) [Unconjugated]](https://images.novusbio.com/images/pp-h7223-00_human-pnr-nr2e3-mab-clone-h7223-41202412505322.jpg)
![Flow Cytometry Mer Antibody [Unconjugated]](https://images.novusbio.com/images2/Mer_AF591_Flow_Cytometry_12100.jpg)
![Immunohistochemistry Mer Antibody [Unconjugated]](https://images.novusbio.com/images2/Mer_AF591_Immunohistochemistry_22755.jpg)
![Dual RNAscope ISH-IHC Compatible Mer Antibody [Unconjugated]](https://images.novusbio.com/images2/Mer_AF591_Dual_RNAscope_ISHIHC_23834.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
