Novus Biologicals products are now on bio-techne.com

Recombinant Human TTF-1 / NKX2-1 GST (N-Term) Protein

Name: Recombinant Human TTF-1 / NKX2-1 GST (N-Term) Protein
Brand: Novus Biologicals
SKU: H00007080-Q01
Price: 569 USD

Submit a Review

Images

(

Enlarge)

SDS-Page: TTF1 / NKX2.1 Partial Recombinant Protein [H00007080-Q01] - 12.5%, Stained with Coomassie Blue.

Product Details

Summary

Reactivity	HuSpecies Glossary
Applications	WB, ELISA, MA, AP

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Recombinant Human TTF-1 / NKX2-1 GST (N-Term) Protein Summary

Description	A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 56-147 of Human TTF1 / NKX2.1 Source: Wheat Germ (in vitro) Amino Acid Sequence: HAVGHHGAVTAAYHMTAAGVPQLSHSAVGGYCNGNLGNMSELPPYQDTMRNSASGPGWYGANPDPRFPAISRFMGPASGMNMSGMGGLGSLG
Preparation Method	in vitro wheat germ expression system
Details of Functionality	This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source	Wheat germ
Protein/Peptide Type	Recombinant Protein
Gene	NKX2-1
Purity	>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions	ELISA Immunoaffinity Purification Protein Array Western Blot
Theoretical MW	35.75 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage	Store at -80C. Avoid freeze-thaw cycles.
Buffer	50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative	No Preservative
Purity	>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human TTF-1 / NKX2-1 GST (N-Term) Protein

BCH
benign chorea
BHC
Homeobox protein NK-2 homolog A
homeobox protein Nkx-2.1
NK2 homeobox 1
NK-2 homolog A
NKX2.1
NKX2-1
NKX2A
NKX2ANKX2.1
T/EBP
Thyroid nuclear factor 1
Thyroid transcription factor 1BHC
TITF1
TITF1TEBP
TTF1
TTF-1
TTF1BCH
TTF-1NK-2

Background

TITF1 - thyroid transcription factor 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Thyroglobulin
Antibody (2H11 + 6E1)

NBP2-34294

Immunohistochemistry Thyroglobulin Antibody (2H11 + 6E1)

(3 Reviews)

(1 Publication)

Species: Hu, Mu, Rt

Applications: Flow, IHC, IHC-P

Cytokeratin 20
Antibody (SA35-03)

NBP2-67309

Immunocytochemistry/ Immunofluorescence Cytokeratin 20 Antibody (SA35-03)

Immunohistochemistry-Paraffin Cytokeratin 20 Antibody (SA35-03)

Species: Hu, Rt

Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB

Substance P
Antibody (266815)

MAB4375

(1 Review)

(9 Publications)

Species: Hu, Mu, Rt

Applications: IHC

Cytokeratin 7
Antibody (OV-TL12/30) ...

NBP2-47940

Flow Cytometry Cytokeratin 7 Antibody (OV-TL12/30) - Azide and BSA Free

(1 Review)

(1 Publication)

Species: Hu, Mu

Applications: CyTOF-ready, Flow, ICC/IF, IF, IHC, IHC-P, Simple Western, WB

Recombinant Human
SP-B/Surfactant Prote ...

H00006439-P01

(2 Publications)

Species: Hu

Applications: ELISA, AP, PA, WB

Thyroid Peroxidase
Antibody

NBP1-80670

(4 Publications)

Species: Hu

Applications: IHC, IHC-P, WB

PAX8 Antibody

NBP1-32440

Immunohistochemistry-Paraffin PAX8 Antibody

Immunocytochemistry/ Immunofluorescence PAX8 Antibody

(1 Review)

(16 Publications)

Species: Ca, Hu, Mu, Rt

Applications: ChIP, ICC/IF, IHC, IHC-P, IP, Simple Western, Single-Cell Western, WB

Prosurfactant
Protein C Antibody

NBP1-87201

Immunohistochemistry-Paraffin Prosurfactant Protein C Antibody

(1 Publication)

Species: Hu

Applications: IHC, IHC-P, WB

CKAP4/p63 Antibody
[Unconjugated]

AF7355

Western Blot CKAP4/p63 Antibody [Unconjugated]

(2 Publications)

Species: Hu

Applications: ICC, Simple Western, WB

p63/TP73L Antibody
[Unconjugated]

AF1916

Immunocytochemistry p63/TP73L Antibody [Unconjugated]

Immunocytochemistry/ Immunofluorescence p63/TP73L Antibody [Unconjugated]

(1 Review)

(24 Publications)

Species: Hu

Applications: ICC, IHC, WB

EGFR Antibody
[Unconjugated]

AF231

Immunocytochemistry EGFR Antibody [Unconjugated]

Western Blot EGFR Antibody [Unconjugated]

(30 Publications)

Species: Hu

Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB

Uteroglobin/SCGB1A1 An ...

MAB4218

(1 Review)

(28 Publications)

Species: Hu

Applications: IHC, WB

TFF2 Antibody
(366508) [Unconjugate

MAB4077

(1 Publication)

Species: Hu

Applications: IHC, WB

FOXE1 Antibody

NB100-1271

(1 Publication)

Species: Hu

Applications: IHC, IHC-P, PEP-ELISA

beta-1,3-Glucuronyltra ...

NBP1-19788

Immunohistochemistry beta-1,3-Glucuronyltransferase 1/B3GAT1 Antibody - BSA Free

(1 Publication)

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P

RPE65 Antibody
(401.8B11.3D9) - BSA ...

NB100-355

Immunohistochemistry-Frozen RPE65 Antibody (401.8B11.3D9) - BSA Free

Western Blot RPE65 Antibody (401.8B11.3D9) - BSA Free

(7 Reviews)

(97 Publications)

Species: Bv, Ca, Ch, Hu, Mu, Po, Pm, Rt, Xp

Applications: CyTOF-ready, Flow, ICC/IF, IF, IHC, IHC-Fr, IHC-P, IP, In vivo, KO, Simple Western, WB

UVRAG Antibody

NBP1-18885

(3 Publications)

Species: Hu

Applications: ICC/IF, IHC, IHC-P, IP, KO, WB

TSHR Antibody
(484405) [Unconjugate

MAB6534

ELISA TSHR Antibody (484405) [Unconjugated]

Species: Hu

Applications: ELISA, WB

Synaptophysin
Antibody

NB300-653

Immunohistochemistry-Paraffin Synaptophysin Antibody

(2 Reviews)

(11 Publications)

Species: Ch, Fe, Hu, Pm, Mu, Rt

Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB

DDT Antibody
(OTI1H3)

NBP2-45677

Species: Hu, Pm

Applications: IHC, IHC-P, WB

Publications for TTF-1 / NKX2-1 Partial Recombinant Protein (H00007080-Q01) (0)

There are no publications for TTF-1 / NKX2-1 Partial Recombinant Protein (H00007080-Q01).

By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TTF-1 / NKX2-1 Partial Recombinant Protein (H00007080-Q01) (0)

There are no reviews for TTF-1 / NKX2-1 Partial Recombinant Protein (H00007080-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.

Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TTF-1 / NKX2-1 Partial Recombinant Protein (H00007080-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TTF-1 / NKX2-1 Products

Research Areas for TTF-1 / NKX2-1 Partial Recombinant Protein (H00007080-Q01)

Find related products by research area.

Blogs on TTF-1 / NKX2-1

There are no specific blogs for TTF-1 / NKX2-1, but you can read our latest blog posts.

Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

RPE65 Antibody (401.8B11.3D9) - BSA Free
NB100-355

Uteroglobin/SCGB1A1 was detected in immersion fixed paraffin-embedded sections of human lung using 15 µg/mL Rat Anti-Human Uteroglobin/SCGB1A1 Monoclonal Antibody (Catalog # MAB4218) overnight at 4 °C. Before incubation with the primary antibody tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained with the Anti-Rat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS017) and counterstained with hematoxylin (blue). Specific labeling was localized to the cytoplasm of bronchiolar Clara cells. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.

Uteroglobin/SCGB1A1 Antibody (394324) [Unconjugated]
MAB4218

Contact Information

Product PDFs

SDS

PDF Datasheet

Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

Volume

Mass

Concentration

Review this Product

Be the first to review our Recombinant Human TTF-1 / NKX2-1 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol

NKX2-1

Popular Products	Company Information	Support	Stay Connected
Antibodies Secondary Antibodies Isotype Controls Proteins and Peptides ELISA Kits Sample Size New Products	About Us Careers Novus Guarantee Contact Us Our Team	Technical Support FAQs Help Finding Antibodies Protocols

Visit our other sites

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

Recombinant Human TTF-1 / NKX2-1 GST (N-Term) Protein

Species Glossary

Images

Product Details

Order Details

Recombinant Human TTF-1 / NKX2-1 GST (N-Term) Protein Summary

Applications/Dilutions

Packaging, Storage & Formulations

Notes

Alternate Names for Recombinant Human TTF-1 / NKX2-1 GST (N-Term) Protein

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for TTF-1 / NKX2-1 Partial Recombinant Protein (H00007080-Q01) (0)

Reviews for TTF-1 / NKX2-1 Partial Recombinant Protein (H00007080-Q01) (0)

Product General Protocols

Video Protocols

FAQs for TTF-1 / NKX2-1 Partial Recombinant Protein (H00007080-Q01) (0)

Additional TTF-1 / NKX2-1 Products

Research Areas for TTF-1 / NKX2-1 Partial Recombinant Protein (H00007080-Q01)

Blogs on TTF-1 / NKX2-1

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Review this Product

Bioinformatics