![Western Blot: TRPC5 Antibody [NBP2-82363] - WB Suggested Anti-TRPC5 antibody Titration: 1 ug/mL. Sample Type: Human 293T Whole Cell](http://images.novusbio.com/fullsize/TRPC5-Antibody-Western-Blot-NBP2-82363-img0001.jpg "Western Blot: TRPC5 Antibody [NBP2-82363] - WB Suggested Anti-TRPC5 antibody Titration: 1 ug/mL. Sample Type: Human 293T Whole Cell")
| Reactivity | HuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Concentration | 0.5 mg/ml |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human TRPC5. Peptide sequence: NIIPSPKSFLYLGNWFNNTFCPKRDPDGRRRRRNLRSFTERNADSLIQNQ The peptide sequence for this immunogen was taken from within the described region. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | TRPC5 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Theoretical MW | 107 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Concentration | 0.5 mg/ml |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for TRPC5 Antibody (NBP2-82363)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | TRPC5 |
![Immunohistochemistry Clusterin/APOJ Antibody [Unconjugated]](https://images.novusbio.com/images2/Clusterin_AF2747_Immunohistochemistry_9945.jpg)
![Immunohistochemistry Clusterin/APOJ Antibody [Unconjugated]](https://images.novusbio.com/images2/Clusterin_AF2747_Immunohistochemistry_9946.jpg)
![Western Blot Clusterin/APOJ Antibody [Unconjugated]](https://images.novusbio.com/images/af2747_mouse-clusterin-affinity-purified-polyclonal-ab-4120241240247.jpg)
![Immunohistochemistry Endorepellin/Perlecan/Heparan Sulfate Proteoglycan Antibody [Unconjugated]](https://images.novusbio.com/images2/Endorepellin_AF2364_Immunohistochemistry_6744.jpg)
![Immunohistochemistry EphA3 Antibody [Unconjugated]](https://images.novusbio.com/images2/EphA3_AF640_Immunohistochemistry_19184.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
