![Western Blot: TROVE2 Antibody [NBP1-86998] - Ro60 and La proteins are depressed in RRMS (Relapsing remitting multiple sclerosis). (C) Western blotting to determine Ro60 and La protein levels in PBMC from CTRL (N = 9) and RRMS (N = 8). Image collected and cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/25885816) licensed under a CC-BY license.](http://images.novusbio.com/fullsize/TROVE2-Antibody-Western-Blot-NBP1-86998-img0004.jpg "Western Blot: TROVE2 Antibody [NBP1-86998] - Ro60 and La proteins are depressed in RRMS (Relapsing remitting multiple sclerosis). (C) Western blotting to determine Ro60 and La protein levels in PBMC from CTRL (N = 9) and RRMS (N = 8). Image collected and cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/25885816) licensed under a CC-BY license.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC, IP |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: FLLAVDVSASMNQRVLGSILNASTVAAAMCMVVTRTEKDSYVVAFSDEMVPCPVTTDMTLQQVLMAMSQIPAGGTDCSLPMIWAQKTNTPADVFIVFTDNETFAGGVHPAIALREYRKKMDIPAKLIVCGMTSNGF |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | RO60 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | Use in immunprecipitation reported in scientific literature (PMID 25885816). TROVE2 antibody validated for WB from a verified customer review. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Reviewed Applications |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publication using NBP1-86998 | Applications | Species |
|---|---|---|
| Spurlock CF 3rd, Tossberg JT, Guo Y et al. Defective structural RNA processing in relapsing-remitting multiple sclerosis. Genome Biol 2015-01-01 [PMID: 25885816] (IP) | IP |
| Images | Ratings | Applications | Species | Date | Details | ||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
-(01-ml)_NBP1-86998_8491.jpg)
Enlarge |
reviewed by:
Charles Spurlock |
WB | Human | 06/30/2014 |
Summary
|
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | RO60 |
![Immunohistochemistry-Paraffin: TROVE2 Antibody [NBP1-86998] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.](http://images.novusbio.com/fullsize/TROVE2-Antibody-Immunohistochemistry-Paraffin-NBP1-86998-img0002.jpg "Immunohistochemistry-Paraffin: TROVE2 Antibody [NBP1-86998] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.")
![Western Blot: TROVE2 Antibody [NBP1-86998] - Analysis in human cell line K562.](http://images.novusbio.com/fullsize/TROVE2-Antibody-Western-Blot-NBP1-86998-img0003.jpg "Western Blot: TROVE2 Antibody [NBP1-86998] - Analysis in human cell line K562.")
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")
-(01-ml)_NBP1-86998_8491.jpg)