![Western Blot: TRIB2 Antibody (1B1) [H00028951-M04] - Analysis of TRIB2 expression in transfected 293T cell line by TRIB2 monoclonal antibody (M04), clone 1B1. Lane 1: TRIB2 transfected lysatE (38.8 KDa). Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/TRIB2-Antibody-1B1-Western-Blot-H00028951-M04-img0007.jpg "Western Blot: TRIB2 Antibody (1B1) [H00028951-M04] - Analysis of TRIB2 expression in transfected 293T cell line by TRIB2 monoclonal antibody (M04), clone 1B1. Lane 1: TRIB2 transfected lysatE (38.8 KDa). Lane 2: Non-transfected lysate.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA, ICC/IF, IHC, KD |
| Clone | 1B1 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Immunogen | TRIB2 (NP_067675, 254 a.a. ~ 343 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. FHDIEPSSLFSKIRRGQFNIPETLSPKAKCLIRSILRREPSERLTSQEILDHPWFSTDFSVSNSAYGAKEVSDQLVPDVNMEENLDPFFN |
| Specificity | TRIB2 (1B1) |
| Isotype | IgG2b Lambda |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | TRIB2 |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for RNAi validation, immunohistochemistry (paraffin) and ELISA. Use in Immunocytochemistry/immunofluorescence reported in scientific literature (PMID 24089522) |
||
| Control |
|
||
| Publications |
|
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | Protein A purified |
![Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Western_Blot_5930.jpg)
![Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/16332.jpg)
![Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Flow_Cytometry_8283.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for TRIB2 Antibody (H00028951-M04)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: TRIB2 Antibody (1B1) [H00028951-M04] - Analysis of monoclonal antibody to TRIB2 on formalin-fixed paraffin-embedded human colon. Antibody concentration 3 ug/ml](http://images.novusbio.com/fullsize/TRIB2-Antibody-1B1-Immunohistochemistry-Paraffin-H00028951-M04-img0006.jpg "Immunohistochemistry-Paraffin: TRIB2 Antibody (1B1) [H00028951-M04] - Analysis of monoclonal antibody to TRIB2 on formalin-fixed paraffin-embedded human colon. Antibody concentration 3 ug/ml")
![Western Blot: TRIB2 Antibody (1B1) [H00028951-M04] - TRIB2 expression in Jurkat ( Cat # L017V1 ).](http://images.novusbio.com/fullsize/TRIB2-Antibody-1B1-Western-Blot-H00028951-M04-img0002.jpg "Western Blot: TRIB2 Antibody (1B1) [H00028951-M04] - TRIB2 expression in Jurkat ( Cat # L017V1 ).")
![Western Blot: TRIB2 Antibody (1B1) [H00028951-M04] - TRIB2 over-expressed 293 cell line, cotransfected with TRIB2 Validated Chimera RNAi or non-transfected control. Blot probed with H00028951-M04. GAPDH (36.1 kDa) used as loading control.](http://images.novusbio.com/fullsize/TRIB2-Antibody-1B1-Western-Blot-H00028951-M04-img0004.jpg "Western Blot: TRIB2 Antibody (1B1) [H00028951-M04] - TRIB2 over-expressed 293 cell line, cotransfected with TRIB2 Validated Chimera RNAi or non-transfected control. Blot probed with H00028951-M04. GAPDH (36.1 kDa) used as loading control.")
![ELISA: TRIB2 Antibody (1B1) [H00028951-M04] - Detection limit for recombinant GST tagged TRIB2 is approximately 0.03ng/ml as a capture antibody.](http://images.novusbio.com/fullsize/TRIB2-Antibody-1B1-ELISA-H00028951-M04-img0005.jpg "ELISA: TRIB2 Antibody (1B1) [H00028951-M04] - Detection limit for recombinant GST tagged TRIB2 is approximately 0.03ng/ml as a capture antibody.")
![Western Blot c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Western_Blot_18923.jpg)
![Immunocytochemistry c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Immunocytochemistry__Immunofluorescence_18945.jpg)
![Simple Western c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Simple_Western_19175.jpg)
![N/A IL-10 [Biotin]](https://images.novusbio.com/images2/DATA_IL10_DY417_ELISA_2014.jpg)
![Bioactivity IL-2 [Unconjugated]](https://images.novusbio.com/images/202-il_recombinant-human-il-2-protein-bioactivity-174202314946.jpg)
![Immunohistochemistry Cathepsin B Antibody [Unconjugated]](https://images.novusbio.com/images2/Cathepsin_B_AF965_Immunohistochemistry_6922.jpg)
![Immunocytochemistry/ Immunofluorescence Cathepsin B Antibody [Unconjugated]](https://images.novusbio.com/images/af965_mouse-cathepsin-b-affinity-purified-polyclonal-ab-822024950321.jpg)
![Immunocytochemistry/ Immunofluorescence Cathepsin B Antibody [Unconjugated]](https://images.novusbio.com/images/af965_mouse-cathepsin-b-affinity-purified-polyclonal-ab-822024950468.jpg)
