Home » Topo III beta » Topo III beta Proteins » Topo III beta Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

Topo III beta Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for Topo III beta Recombinant Protein Antigen (NBP3-17775PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Topo III beta Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Topo III beta

Source: E. coli

Amino Acid Sequence: TIKLYKELRCPLDDFELVLWSSGSRGKSYPLCPYCYNHPPFRDMKKGMGCNECTHPSCQHSLSMLGIGQCVECESGVLVLDPTSGPKWKVACNKCNVV

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
TOP3B
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-17775.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking tide related information and a protocol, click here.
Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Topo III beta Recombinant Protein Antigen

  • DNA topoisomerase 3-beta-1
  • DNA topoisomerase III beta-1
  • EC 5.99.1.2
  • FLJ39376
  • TOP3B1
  • topoisomerase (DNA) III beta
  • topoisomerase III beta

Background

Topo III beta encodes a DNA topoisomerase, an enzyme that controls and alters the topologic states of DNA during transcription. This enzyme catalyzes the transient breaking and rejoining of a single strand of DNA which allows the strands to pass through one another, thus relaxing the supercoils and altering the topology of DNA. The enzyme interacts with DNA helicase SGS1 and plays a role in DNA recombination, cellular aging and maintenance of genome stability. Alternative splicing of the C-terminus of this gene results in three transcript variants which have distinct tissue specificity; however, not all variants have been fully described.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

CXCL1/GRO
alpha/KC/CINC-1 [Biot
DY453
N/A CXCL1/GRO alpha/KC/CINC-1 [Biotin]
(288 Publications)
Species: Mu
Applications: ELISA
c-Myc Antibody
(9E10) - BSA Free
NB600-302
Flow Cytometry c-Myc Antibody (9E10) - BSA Free
Flow Cytometry c-Myc Antibody (9E10) - BSA Free
Western Blot c-Myc Antibody (9E10) - BSA Free
(4 Reviews)
(46 Publications)
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
Ikaros/IKZF1
Antibody [Unconjugate
AF4984
Western Blot Ikaros/IKZF1 Antibody [Unconjugated]
Chromatin Immunoprecipitation (ChIP) Ikaros/IKZF1 Antibody [Unconjugated]
Simple Western Ikaros/IKZF1 Antibody [Unconjugated]
(2 Publications)
Species: Hu
Applications: ChIP, CyTOF-ready, ICC, ICFlow, Simple Western, WB
p53 Antibody (PAb
240) - BSA Free
NB200-103
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow (Intracellular) p53 Antibody (PAb 240) - BSA Free
(3 Reviews)
(42 Publications)
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Thioredoxin-1
Antibody - BSA Free
NBP2-52983
Flow Cytometry Thioredoxin-1 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence Thioredoxin-1 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence Thioredoxin-1 Antibody - BSA Free
(1 Publication)
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
SPARC Antibody
[Unconjugated]
AF942
Western Blot SPARC Antibody [Unconjugated]
Immunohistochemistry SPARC Antibody [Unconjugated]
Immunocytochemistry SPARC Antibody [Unconjugated]
(38 Publications)
Species: Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow, WB
ABCD4 Antibody
NBP2-21601
Immunocytochemistry/ Immunofluorescence ABCD4 Antibody
Western Blot ABCD4 Antibody
Immunohistochemistry-Paraffin ABCD4 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
MED15 Antibody
(OTI1C11)
NBP2-45780
Immunohistochemistry MED15 Antibody (OTI1C11)
Immunohistochemistry MED15 Antibody (OTI1C11)
Immunohistochemistry MED15 Antibody (OTI1C11)
Species: Hu
Applications: IHC, IHC-P, WB
SLC20A1 Antibody
NBP1-32252
Western Blot SLC20A1 Antibody
Immunohistochemistry-Paraffin SLC20A1 Antibody
Immunohistochemistry-Paraffin SLC20A1 Antibody
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
XPF Antibody
(OTI4E11)
NBP2-01020
Flow Cytometry XPF Antibody (OTI4E11)
Western Blot XPF Antibody (OTI4E11)
Immunohistochemistry-Paraffin XPF Antibody (OTI4E11)
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
SH3D19 Antibody
(5C7)
H00152503-M01
Immunocytochemistry/ Immunofluorescence SH3D19 Antibody (5C7)
Immunohistochemistry-Paraffin SH3D19 Antibody (5C7)
Western Blot SH3D19 Antibody (5C7)
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Ku80/XRCC5
Antibody - BSA Free
NB100-508
Western Blot Ku80/XRCC5 Antibody - BSA Free
Immunoprecipitation Ku80/XRCC5 Antibody - BSA Free
Western Blot Ku80/XRCC5 Antibody - BSA Free
(1 Review)
(5 Publications)
Species: Ha, Hu, Mu, Rt
Applications: ChIP, IP, WB
PROP1 Antibody
NBP3-10488
Western Blot PROP1 Antibody
Species: Hu
Applications: WB
EphB2 Antibody
[Unconjugated]
AF467
Simple Western EphB2 Antibody [Unconjugated]
Western Blot EphB2 Antibody [Unconjugated]
Immunocytochemistry EphB2 Antibody [Unconjugated]
(5 Reviews)
(62 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
BubR1 Antibody
(8G1) - BSA Free
NB100-353
Flow Cytometry BubR1 Antibody (8G1) - BSA Free
Immunocytochemistry/ Immunofluorescence BubR1 Antibody (8G1) - BSA Free
Western Blot BubR1 Antibody (8G1) - BSA Free
(1 Review)
(8 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC/IF, IP, WB
Myoglobin Antibody
[Unconjugated]
G-125-C
Myoglobin Antibody [Unconjugated]
Species: Hu
Applications: Secondary
Klotho Antibody
[Unconjugated]
AF1819
Immunohistochemistry Klotho Antibody [Unconjugated]
Western Blot Klotho Antibody [Unconjugated]
ELISA Klotho Antibody [Unconjugated]
(39 Publications)
Species: Mu
Applications: ELISA, IHC, WB
Glutathione
Peroxidase 2/GPX2 Ant
NBP1-32002
Immunohistochemistry-Paraffin Glutathione Peroxidase 2/GPX2 Antibody
Western Blot Glutathione Peroxidase 2/GPX2 Antibody
Western Blot Glutathione Peroxidase 2/GPX2 Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Chk1 Antibody
NB100-464
Immunoprecipitation Chk1 Antibody
Immunohistochemistry-Paraffin Chk1 Antibody
Western Blot Chk1 Antibody
(12 Publications)
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
Topo III beta
Recombinant Protein A ...
NBP3-17775PEP
Topo III beta Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for Topo III beta Recombinant Protein Antigen (NBP3-17775PEP) (0)

There are no publications for Topo III beta Recombinant Protein Antigen (NBP3-17775PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Topo III beta Recombinant Protein Antigen (NBP3-17775PEP) (0)

There are no reviews for Topo III beta Recombinant Protein Antigen (NBP3-17775PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Topo III beta Recombinant Protein Antigen (NBP3-17775PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Topo III beta Products

Research Areas for Topo III beta Recombinant Protein Antigen (NBP3-17775PEP)

Find related products by research area.

Blogs on Topo III beta

There are no specific blogs for Topo III beta, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Simple Western lane view shows lysates of COLO 205 human colorectal adenocarcinoma cell line and MBA‑MB‑468 human breast cancer cell line, loaded at 0.2 mg/mL. A specific band was detected for EphB2 at approximately 139 and 146 kDa (as indicated) using 20 µg/mL of Goat Anti-Human/Mouse EphB2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF467) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
EphB2 Antibody [Unconjugated]
AF467
Flow Cytometry: c-Myc Antibody (9E10) [NB600-302] - An intracellular stain was performed on U-937 cells with c-Myc Antibody (9E10) NB600-302AF488 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 10 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 488.
c-Myc Antibody (9E10) - BSA Free
NB600-302

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Topo III beta Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol TOP3B