![Western Blot: TOMM22 Antibody [NBP1-80671] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2,. Remaining relative intensity is presented. Loading control: Anti-GAPDH.](http://images.novusbio.com/fullsize/TOMM22-Antibody-Western-Blot-NBP1-80671-img0018.jpg "Western Blot: TOMM22 Antibody [NBP1-80671] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2,. Remaining relative intensity is presented. Loading control: Anti-GAPDH.")
| Reactivity | Hu, MuSpecies Glossary |
| Applications | WB, ICC/IF, IHC, KD |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: MAAAVAAAGAGEPQSPDELLPKGDAEKPEEELEEDDDEELDETLSERLWGLTEMFPERVRSAAGATFDLSLFVAQK |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | TOMM22 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for TOMM22 Antibody (NBP1-80671)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Western Blot: TOMM22 Antibody [NBP1-80671] - Comparative immunoblot analysis of normal wild type versus mdx-4cv liver extracts. Immunoblots with expanded views of labelling with antibodies to the mitochondrial outer membrane protein translocation pore subunit TOM22 (NBP1-80671) and asporin (NBP2-15492). Image collected and cropped by CiteAb from the following publication (//clinicalproteomicsjournal.biomedcentral.com/articles/10.1186/s12014-018-9212-2) licensed under a CC-BY license.](http://images.novusbio.com/fullsize/TOMM22-Antibody-Western-Blot-NBP1-80671-img0019.jpg "Western Blot: TOMM22 Antibody [NBP1-80671] - Comparative immunoblot analysis of normal wild type versus mdx-4cv liver extracts. Immunoblots with expanded views of labelling with antibodies to the mitochondrial outer membrane protein translocation pore subunit TOM22 (NBP1-80671) and asporin (NBP2-15492). Image collected and cropped by CiteAb from the following publication (//clinicalproteomicsjournal.biomedcentral.com/articles/10.1186/s12014-018-9212-2) licensed under a CC-BY license.")
![Immunocytochemistry/Immunofluorescence: TOMM22 Antibody [NBP1-80671] - Staining of human cell line A-431 shows localization to mitochondria. Antibody staining shown in green.](http://images.novusbio.com/fullsize/TOMM22-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-80671-img0009.jpg "Immunocytochemistry/Immunofluorescence: TOMM22 Antibody [NBP1-80671] - Staining of human cell line A-431 shows localization to mitochondria. Antibody staining shown in green.")
![Immunohistochemistry-Paraffin: TOMM22 Antibody [NBP1-80671] - Staining of human testis shows strong granular cytoplasmic positivity in cells in seminiferous ducts and Leydig cells..](http://images.novusbio.com/fullsize/TOMM22-Antibody-Immunohistochemistry-Paraffin-NBP1-80671-img0016.jpg "Immunohistochemistry-Paraffin: TOMM22 Antibody [NBP1-80671] - Staining of human testis shows strong granular cytoplasmic positivity in cells in seminiferous ducts and Leydig cells..")
![Western Blot: TOMM22 Antibody [NBP1-80671] - Analysis in human cell line HL-60.](http://images.novusbio.com/fullsize/TOMM22-Antibody-Western-Blot-NBP1-80671-img0017.jpg "Western Blot: TOMM22 Antibody [NBP1-80671] - Analysis in human cell line HL-60.")
![Immunohistochemistry-Paraffin: TOMM22 Antibody [NBP1-80671] - Staining of human duodenum shows strong granular cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/TOMM22-Antibody-Immunohistochemistry-Paraffin-NBP1-80671-img0013.jpg "Immunohistochemistry-Paraffin: TOMM22 Antibody [NBP1-80671] - Staining of human duodenum shows strong granular cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: TOMM22 Antibody [NBP1-80671] - Staining of human fallopian tube shows strong granular cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/TOMM22-Antibody-Immunohistochemistry-Paraffin-NBP1-80671-img0014.jpg "Immunohistochemistry-Paraffin: TOMM22 Antibody [NBP1-80671] - Staining of human fallopian tube shows strong granular cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: TOMM22 Antibody [NBP1-80671] - Staining of human pancreas shows moderate granular cytoplasmic positivity.](http://images.novusbio.com/fullsize/TOMM22-Antibody-Immunohistochemistry-Paraffin-NBP1-80671-img0015.jpg "Immunohistochemistry-Paraffin: TOMM22 Antibody [NBP1-80671] - Staining of human pancreas shows moderate granular cytoplasmic positivity.")
![Western Blot: TOMM22 Antibody [NBP1-80671] - Comparative immunoblot analysis of normal wild type versus mdx-4cv liver extracts. Shown is a representative silver-stained SDS-PAGE gel & corresponding immunoblots with expanded views of labelling with antibodies to the fatty acid binding protein isoforms FABP1 & FABP5, as well as ferritin light chain, carbonic anhydrase isoform CA3, the voltage-dependent anion channel VDAC-1, the mitochondrial outer membrane protein translocation pore subunit TOM22, fibronectin & asporin. Lanes 1 & 2 represent total extracts from control wild type (wt) liver & mdx-4cv liver, respectively. Molecular mass standards (in kDa) are indicated at the left of the gel image. Graphical representations of the immuno-decoration levels of FABP1 & FABP5 are shown (Y-axis: % control): Student’s t test, unpaired; n = 4; *p < 0.05 Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/30386187), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp1-80671_rabbit-polyclonal-tomm22-antibody-310202416175270.jpg "Western Blot: TOMM22 Antibody [NBP1-80671] - Comparative immunoblot analysis of normal wild type versus mdx-4cv liver extracts. Shown is a representative silver-stained SDS-PAGE gel & corresponding immunoblots with expanded views of labelling with antibodies to the fatty acid binding protein isoforms FABP1 & FABP5, as well as ferritin light chain, carbonic anhydrase isoform CA3, the voltage-dependent anion channel VDAC-1, the mitochondrial outer membrane protein translocation pore subunit TOM22, fibronectin & asporin. Lanes 1 & 2 represent total extracts from control wild type (wt) liver & mdx-4cv liver, respectively. Molecular mass standards (in kDa) are indicated at the left of the gel image. Graphical representations of the immuno-decoration levels of FABP1 & FABP5 are shown (Y-axis: % control): Student’s t test, unpaired; n = 4; *p < 0.05 Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/30386187), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Immunohistochemistry GIP Antibody (911205) [Unconjugated]](https://images.novusbio.com/images2/GIP_MAB8864_Immunohistochemistry_17088.jpg)
![C1qTNF1/CTRP1 Antibody [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "C1qTNF1/CTRP1 Antibody [Unconjugated]")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")