| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA, MA, AP |
| Description | A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 1109-1207 of Human Timeless Source: Wheat Germ (in vitro) Amino Acid Sequence: PELQPKVPGEQGSDEEHCKEHRAQALRALLLAHKKKAGLASPEEEDAVGKEPLKAAPKKRQLLDSDEEQEEDEGRNRAPELGAPGIQKKKRYQIEDDED |
| Preparation Method |
in vitro wheat germ expression system |
| Details of Functionality | This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated. |
| Source | Wheat germ |
| Protein/Peptide Type | Partial Recombinant Protein |
| Gene | TIMELESS |
| Purity | >80% by SDS-PAGE and Coomassie blue staining |
| Dilutions |
|
| Theoretical MW | 36.63 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at -80C. Avoid freeze-thaw cycles. |
| Buffer | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
| Preservative | No Preservative |
| Purity | >80% by SDS-PAGE and Coomassie blue staining |
![Immunohistochemistry TIM-3 Antibody [Unconjugated]](https://images.novusbio.com/images2/TIM3_AF2365_Immunohistochemistry_23056.jpg)
![Dual RNAscope ISH-IHC Compatible TIM-3 Antibody [Unconjugated]](https://images.novusbio.com/images2/TIM3_AF2365_Dual_RNAscope_ISHIHC_23829.jpg)
![Knockout Validated TIM-3 Antibody [Unconjugated]](https://images.novusbio.com/images2/af2365_human-tim-3-affinity-purified-polyclonal-ab-knockout-validated-1562021145510.jpg)
Research Areas for Timeless Partial Recombinant Protein (H00008914-Q01)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | TIMELESS |
![SDS-PAGE LIGHT/TNFSF14 [Unconjugated]](https://images.novusbio.com/images2/LIGHT_664-LI_719.jpg)
![Bioactivity LIGHT/TNFSF14 [Unconjugated]](https://images.novusbio.com/images2/LIGHT_664-LI_721.jpg)
![Western Blot TIM-1/KIM-1/HAVCR Antibody [Unconjugated]](https://images.novusbio.com/images2/TIM1_AF1817_Western_Blot_17317.jpg)
![Western Blot TIM-1/KIM-1/HAVCR Antibody [Unconjugated]](https://images.novusbio.com/images/af1817_mouse-tim-1-kim-1-havcr-affinity-purified-polyclonal-ab-4120241049450.jpg)
![Western Blot TIM-4 Antibody [Unconjugated]](https://images.novusbio.com/images2/TIM4_AF2929_Western_Blot_21021.jpg)
![Immunohistochemistry TIM-4 Antibody [Unconjugated]](https://images.novusbio.com/images2/TIM4_AF2929_Immunohistochemistry_23059.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Western Blot: Timeless Antibody [NB100-40853] - Samples: Whole cell lysate (0.5 or 1.0 mg per IP reaction; 20% of IP loaded) from HeLa cells prepared using NETN lysis buffer. Antibodies: Affinity purified rabbit anti-Timeless antibody NB100-40853 used for IP at 6 ug per reaction. Timeless was also immunoprecipitated by rabbit anti-Timeless antibody NB100-40852. For blotting immunoprecipitated Timeless, NB100-40853 was used at 0.4 ug/ml. Detection: Chemiluminescence with an exposure time of 30 seconds.](https://images.novusbio.com/images/Timeless-Antibody-Western-Blot-NB100-40853-img0003.jpg "Western Blot: Timeless Antibody [NB100-40853] - Samples: Whole cell lysate (0.5 or 1.0 mg per IP reaction; 20% of IP loaded) from HeLa cells prepared using NETN lysis buffer. Antibodies: Affinity purified rabbit anti-Timeless antibody NB100-40853 used for IP at 6 ug per reaction. Timeless was also immunoprecipitated by rabbit anti-Timeless antibody NB100-40852. For blotting immunoprecipitated Timeless, NB100-40853 was used at 0.4 ug/ml. Detection: Chemiluminescence with an exposure time of 30 seconds.")